KEGG   Rattus norvegicus (rat): 58976Help
Entry
58976             CDS       T01003                                 

Gene name
Slc30a1
Definition
(RefSeq) solute carrier family 30 member 1
  KO
K14688  
solute carrier family 30 (zinc transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    58976 (Slc30a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC30: Zinc efflux transporter
   58976 (Slc30a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q27
AA seq 507 aa AA seqDB search
MGCWGRNRGRLLCMLLLTFMFMVLEVVVSRVTASLAMLSDSFHMLSDVLALVVALVAERF
ARRTHATQKNTFGWIRAEVMGALVNAIFLTGLCFAILLEAVERFIEPHEMQQPLVVLSVG
VAGLLVNVLGLCLFHHHSGEGQGAGHGHSHGHGHGHLAKGARKAGRAGGEAGAPPGRAPD
QEPDQEETNTLVANTSNSNGLKADQAEPEKLRSDDPVDVQVNGNLIQESDSLESEDNRAG
QLNMRGVFLHVLGDALGSVIVVVNALVFYFSWKGCTEDDFCVNPCFPDPCKSSVELMNST
QAPMHEAGPCWVLYLDPTLCIIMVCILLYTTYPLLKESALILLQTVPKQIDIKHLVKELR
DVEGVEEVHELHVWQLAGSRIIATAHIKCEDPASYMQVAKTIKDVFHNHGIHATTIQPEF
ASVGSKSSVVPCELACRTQCALKQCCGTRPQVHSGKEAEKAPTVSISCLELSENLEKKPR
RTKAEGSVPAVVIEIKNVPNKQPESSL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctggggccgcaaccgcggccggctgctgtgcatgctgctgctgaccttcatg
ttcatggtgctggaggtggtggtgagccgggtgaccgcgtcgctcgccatgctgtccgac
tccttccacatgctgtcggacgtgctggcgctcgtggtggcgctggtggccgagcgcttc
gcccggaggactcacgccacgcagaagaacacattcggctggatccgcgctgaggtgatg
ggcgcgctggtgaacgccatcttcctcacggggctgtgcttcgccatcctgctggaagcc
gtcgagcgcttcatcgagccgcatgagatgcagcagccgctcgtggtgcttagcgtcggc
gtggcggggctgctagtcaacgtgctggggctctgcctgttccaccaccacagcggcgag
ggccagggcgcaggccacggccactcgcacggccacggccacggccacctcgccaagggc
gcgcgcaaggcgggccgcgcggggggcgaagcgggcgcgccgccgggccgggcgccggac
caggagccggaccaggaggagaccaacacgctagtggctaacaccagcaattccaacggg
ctgaaggcggaccaggcagagccagagaagttgagaagtgatgatccagtggatgtacag
gtaaatgggaatctcatccaggagtcagacagtctggaatcagaagacaacagggctgga
cagctgaacatgcgaggagtgtttctgcacgtccttggagatgccctgggctctgtgatc
gttgttgtgaatgccttggtcttctacttttcctggaagggttgtactgaagacgacttt
tgtgtgaacccgtgttttcctgatccctgcaaatcgtctgtagagctgatgaacagcacc
caggcccccatgcacgaggctggtccgtgctgggtcctctacctagatccaaccctgtgc
attataatggtttgtatacttctttacacgacgtacccactgctcaaggagtccgctctc
attcttctacagactgttcctaagcaaattgatatcaaacatttggtaaaagagctacga
gatgttgaaggagtggaggaagtccatgagttacacgtctggcagctcgccggaagcagg
atcatcgccactgctcatataaaatgtgaagacccagcttcatacatgcaggtggccaaa
accattaaagatgtttttcacaatcatggaattcacgccaccaccatccagcctgaattc
gctagcgtaggctctaaatcaagtgtcgtcccgtgtgagctcgcctgcagaactcagtgt
gctttgaagcagtgctgtgggacacggccacaggtccattctggaaaggaggcagagaag
gctccaacagttagcatttcttgtttagaactcagtgaaaacctagagaagaagcccagg
aggactaaagctgaaggcagtgtccccgctgtggtgatagagattaaaaatgtgccaaac
aaacagcccgaatcatctttgtga

DBGET integrated database retrieval system