KEGG   Rattus norvegicus (rat): 59102Help
Entry
59102             CDS       T01003                                 

Gene name
Rpa2
Definition
(RefSeq) replication protein A2
  KO
K10739  replication factor A2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno03420  Nucleotide excision repair
rno03430  Mismatch repair
rno03440  Homologous recombination
rno03460  Fanconi anemia pathway
Module
rno_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    59102 (Rpa2)
   03420 Nucleotide excision repair
    59102 (Rpa2)
   03430 Mismatch repair
    59102 (Rpa2)
   03440 Homologous recombination
    59102 (Rpa2)
   03460 Fanconi anemia pathway
    59102 (Rpa2)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    59102 (Rpa2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     59102 (Rpa2)
   MMR (mismatch exicision repair)
     59102 (Rpa2)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     59102 (Rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPA_C tRNA_anti-codon MarR_2
Motif
Other DBs
NCBI-GeneID: 59102
NCBI-ProteinID: NP_067593
RGD: 619714
Ensembl: ENSRNOG00000013005
UniProt: Q63528
Position
5q36
AA seq 270 aa AA seqDB search
MWNSGFESFSSSSYGAAGGYTQSPGGFGSPTPSQAEKKSRARAQHIVPCTISQLLSATLT
DEVFKIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSGENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHLMLSKANSQASVGR
PSMSNPGMGEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVA
SIKQAVDFLCNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagcggattcgaaagcttcagcagctcctcctatggcgcagcgggcggctac
acgcagtcccccggtggcttcgggtcacccacaccgtcgcaggcagagaagaaatcaaga
gcccgagcccagcacattgtgccctgtaccatatctcagctgctctctgctactctgact
gatgaggtgttcaaaattggggatgtcgagatttcacaggtcactattgtgggaataatc
agacatgcagagaaagcgccaaccaacattgtctacaaaatagacgacatgaccgcagcg
cccatggacgttcgccagtgggttgacacagatgataccagtggcgagaacactgtggtt
cctccagaaacatacgtgaaagttgctggccacctcaggtcttttcagaacaaaaagagc
ctggtggcctttaagatcattcctctggaggatatgaatgagttcacggcgcacattctg
gaagtggtcaattcacacttgatgctcagcaaagccaacagccaggcctctgtagggaga
ccatctatgagcaacccaggaatgggtgagccaggaaacttcagtgggaataacttcatg
ccagcaaatggcctcaccgtggtccaaaaccaggtgctgaatttgattaaggcttgccca
agacctgaaggattgaacttccaggatctcaggagccagctccagcacatgcctgtagcc
tcaatcaaacaagcagtggattttctatgcaacgagggccacatttactctacagtggat
gatgatcactttaaatccacggacgcagagtaa

DBGET integrated database retrieval system