KEGG   Rattus norvegicus (rat): 59102Help
Entry
59102             CDS       T01003                                 

Gene name
Rpa2
Definition
replication protein A2
Orthology
K10739  
replication factor A2
Organism
rno  Rattus norvegicus (rat)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    59102 (Rpa2)
   03420 Nucleotide excision repair
    59102 (Rpa2)
   03430 Mismatch repair
    59102 (Rpa2)
   03440 Homologous recombination
    59102 (Rpa2)
   03460 Fanconi anemia pathway
    59102 (Rpa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 270 aa AA seqDB search
MWNSGFESFSSSSYGAAGGYTQSPGGFGSPTPSQAEKKSRARAQHIVPCTISQLLSATLT
DEVFKIGDVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVRQWVDTDDTSGENTVV
PPETYVKVAGHLRSFQNKKSLVAFKIIPLEDMNEFTAHILEVVNSHLMLSKANSQASVGR
PSMSNPGMGEPGNFSGNNFMPANGLTVVQNQVLNLIKACPRPEGLNFQDLRSQLQHMPVA
SIKQAVDFLCNEGHIYSTVDDDHFKSTDAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatagcggattcgaaagcttcagcagctcctcctatggcgcagcgggcggctac
acgcagtcccccggtggcttcgggtcacccacaccgtcgcaggcagagaagaaatcaaga
gcccgagcccagcacattgtgccctgtaccatatctcagctgctctctgctactctgact
gatgaggtgttcaaaattggggatgtcgagatttcacaggtcactattgtgggaataatc
agacatgcagagaaagcgccaaccaacattgtctacaaaatagacgacatgaccgcagcg
cccatggacgttcgccagtgggttgacacagatgataccagtggcgagaacactgtggtt
cctccagaaacatacgtgaaagttgctggccacctcaggtcttttcagaacaaaaagagc
ctggtggcctttaagatcattcctctggaggatatgaatgagttcacggcgcacattctg
gaagtggtcaattcacacttgatgctcagcaaagccaacagccaggcctctgtagggaga
ccatctatgagcaacccaggaatgggtgagccaggaaacttcagtgggaataacttcatg
ccagcaaatggcctcaccgtggtccaaaaccaggtgctgaatttgattaaggcttgccca
agacctgaaggattgaacttccaggatctcaggagccagctccagcacatgcctgtagcc
tcaatcaaacaagcagtggattttctatgcaacgagggccacatttactctacagtggat
gatgatcactttaaatccacggacgcagagtaa

DBGET integrated database retrieval system