KEGG   Rattus norvegicus (rat): 59109Help
Entry
59109             CDS       T01003                                 

Gene name
Ntrk1, Trk
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1 (EC:2.7.10.1)
  KO
K03176  
neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Endocytosis
Apoptosis
Neurotrophin signaling pathway
Inflammatory mediator regulation of TRP channels
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    59109 (Ntrk1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    59109 (Ntrk1)
  Cell growth and death
   04210 Apoptosis
    59109 (Ntrk1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    59109 (Ntrk1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    59109 (Ntrk1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    59109 (Ntrk1)
   05230 Central carbon metabolism in cancer
    59109 (Ntrk1)
   05202 Transcriptional misregulation in cancers
    59109 (Ntrk1)
   05216 Thyroid cancer
    59109 (Ntrk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     59109 (Ntrk1)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  Trk family [OT]
   59109 (Ntrk1)
Enzyme-linked receptors [BR:rno01020]
 Receptor tyrosine kinases
  RTK class VII (TRK receptor family)
   59109 (Ntrk1)
Cytokine receptors [BR:rno04050]
 Receptor tyrosine kinase
  RTK class VII (TRK receptor family)
   59109 (Ntrk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 799 aa AA seqDB search
MLRGQRHGQLGWHRPAAGLGGLVTSLMLACACAASCRETCCPVGPSGLRCTRAGTLNTLR
GLRGAGNLTELYVENQRDLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHL
NLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGS
GDQFLPLGHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATM
KKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGKAVEQHH
WCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKKDETPFG
VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLS
PTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQD
KMLVAVKALKETSENARQDFHREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDL
NRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCL
VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVL
WEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDV
HARLQALAQAPPSYLDVLG
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggccagcggcacgggcagctgggttggcatcgcccggccgcggggctaggc
ggtctggtgacttcgttgatgctggcttgtgcttgcgccgcatcctgtcgtgagacctgc
tgtcccgtgggcccctcggggttgcgctgcaccagggcagggaccctgaataccctccgc
ggcctgcggggcgccgggaacctgacggagctctatgtggaaaaccagcgggatctgcaa
cgcctggagtttgaggacctgcagggcctgggggagttgagaagcctaaccatcgtgaag
agtggcctccgctttgtggcccctgatgccttccatttcacccctcggctcagtcacctg
aatctctcctccaatgctttggagtccctctcctggaaaactgtgcagggcctctcccta
caggacttgaccctgtcagggaacccactgcactgttcctgtgccctattgtggctccag
cgctgggagcaggaggatttgtgtggtgtgtatacacaaaagcttcagggctctgggtct
ggagaccagttcctcccactgggacacaacaacagttgtggtgtaccctcagtgaagatc
cagatgcccaatgactctgtggaagtgggggatgacgtttttctgcagtgccaggtggag
gggcaggccctacagcaggctgactggatcctcacagagctggaagggacagccaccatg
aagaaatctggagatctgccatccctggggctaactctggtcaatgtcaccagtgatctc
aacaagaagaatgtgacgtgctgggcagagaatgatgtgggccgggctgaggtctctgtc
caagtcagcgtctccttcccagccagtgtgcatctgggcaaagccgtggaacagcatcac
tggtgcattcccttctctgtggacgggcagccagcaccgtccctgcgctggttcttcaac
ggctctgtgctcaatgagaccagcttcatcttcactcagttcttggagtcagcgctgacc
aatgagaccatgcggcatggctgccttcgcctcaaccagcccacgcatgtcaacaacggg
aactacaccctgctggctgccaacccctatggccaggctgctgcctccatcatggctgcc
tttatggacaacccttttgagttcaaccctgaggaccccatccctgtctccttctcgcca
gtggacactaacagcacatcaagagacccagtggagaagaaggacgaaacaccttttggg
gtctctgtggctgtgggcctggccgtctccgccgccctcttcctttctgccctcctccta
gtgctcaacaaatgtggacagaggagcaaatttgggatcaaccgccctgctgtgctggcg
ccagaggatgggctggccatgtccctacacttcatgacactgggtggcagttctctttcc
cctactgagggcaaaggctccggactccagggccacatcatggagaacccacagtacttc
agtgatacctgtgtccaccatatcaagcgccaggacatcattctcaagtgggagctaggg
gagggagcctttggaaaggtctttcttgctgagtgctacaaccttctgaatgatcaggac
aagatgctggtggctgtcaaggcactgaaggagacatctgagaatgctcgtcaggacttc
catcgtgaggcagagctgctcaccatgctacagcaccaacacatcgtacgcttctttgga
gtctgcacggagggtggcccattgctcatggtcttcgagtacatgcgccatggggacctc
aaccgtttcctccggtcccacggacctgatgcaaaactgctggctggcggcgaggatgtg
gctcctggtcctttgggccttgggcagcttctggctgtggctagccaggtggctgctggt
atggtgtacctagccagcctgcactttgtgcaccgggacctggccacacgcaactgtctg
gtgggtcagggactagtggtcaagattggagacttcggcatgagcagggacatctacagc
acagactactaccgtgtgggaggtcggaccatgctgcccatccgctggatgcctccagag
agcatcctctaccgcaagttcagcaccgagagtgatgtgtggagcttcggggtggtgctc
tgggagatcttcacctatggaaagcaaccctggtaccagctctccaacactgaggcgatc
gagtgcatcacgcagggccgggagctggagcggccgcgcgcctgccctcctgatgtctac
gccatcatgcgcggctgctggcagcgtgagccgcaacagcgcctcagcatgaaggatgtg
cacgcgcggctgcaggccttggcacaggcgccaccgagttacctggacgttctgggctag

DBGET integrated database retrieval system