KEGG   Rattus norvegicus (rat): 59109Help
Entry
59109             CDS       T01003                                 

Gene name
Ntrk1, Trk
Definition
(RefSeq) neurotrophic receptor tyrosine kinase 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04722  Neurotrophin signaling pathway
rno04750  Inflammatory mediator regulation of TRP channels
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05216  Thyroid cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    59109 (Ntrk1)
   04010 MAPK signaling pathway
    59109 (Ntrk1)
   04151 PI3K-Akt signaling pathway
    59109 (Ntrk1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    59109 (Ntrk1)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    59109 (Ntrk1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    59109 (Ntrk1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    59109 (Ntrk1)
   05230 Central carbon metabolism in cancer
    59109 (Ntrk1)
   05202 Transcriptional misregulation in cancers
    59109 (Ntrk1)
   05216 Thyroid cancer
    59109 (Ntrk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     59109 (Ntrk1)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   59109 (Ntrk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 LRR_8 I-set Ig_3 Ig_2 ig LRR_4
Motif
Other DBs
NCBI-GeneID: 59109
NCBI-ProteinID: NP_067600
RGD: 620144
Ensembl: ENSRNOG00000013953
Vega: OTTRNOG00000002275
UniProt: P35739
Position
2q34
AA seq 799 aa AA seqDB search
MLRGQRHGQLGWHRPAAGLGGLVTSLMLACACAASCRETCCPVGPSGLRCTRAGTLNTLR
GLRGAGNLTELYVENQRDLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFHFTPRLSHL
NLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALLWLQRWEQEDLCGVYTQKLQGSGS
GDQFLPLGHNNSCGVPSVKIQMPNDSVEVGDDVFLQCQVEGQALQQADWILTELEGTATM
KKSGDLPSLGLTLVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGKAVEQHH
WCIPFSVDGQPAPSLRWFFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQAAASIMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSRDPVEKKDETPFG
VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLS
PTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQD
KMLVAVKALKETSENARQDFHREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDL
NRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCL
VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVL
WEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDV
HARLQALAQAPPSYLDVLG
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggccagcggcacgggcagctgggttggcatcgcccggccgcggggctaggc
ggtctggtgacttcgttgatgctggcttgtgcttgcgccgcatcctgtcgtgagacctgc
tgtcccgtgggcccctcggggttgcgctgcaccagggcagggaccctgaataccctccgc
ggcctgcggggcgccgggaacctgacggagctctatgtggaaaaccagcgggatctgcaa
cgcctggagtttgaggacctgcagggcctgggggagttgagaagcctaaccatcgtgaag
agtggcctccgctttgtggcccctgatgccttccatttcacccctcggctcagtcacctg
aatctctcctccaatgctttggagtccctctcctggaaaactgtgcagggcctctcccta
caggacttgaccctgtcagggaacccactgcactgttcctgtgccctattgtggctccag
cgctgggagcaggaggatttgtgtggtgtgtatacacaaaagcttcagggctctgggtct
ggagaccagttcctcccactgggacacaacaacagttgtggtgtaccctcagtgaagatc
cagatgcccaatgactctgtggaagtgggggatgacgtttttctgcagtgccaggtggag
gggcaggccctacagcaggctgactggatcctcacagagctggaagggacagccaccatg
aagaaatctggagatctgccatccctggggctaactctggtcaatgtcaccagtgatctc
aacaagaagaatgtgacgtgctgggcagagaatgatgtgggccgggctgaggtctctgtc
caagtcagcgtctccttcccagccagtgtgcatctgggcaaagccgtggaacagcatcac
tggtgcattcccttctctgtggacgggcagccagcaccgtccctgcgctggttcttcaac
ggctctgtgctcaatgagaccagcttcatcttcactcagttcttggagtcagcgctgacc
aatgagaccatgcggcatggctgccttcgcctcaaccagcccacgcatgtcaacaacggg
aactacaccctgctggctgccaacccctatggccaggctgctgcctccatcatggctgcc
tttatggacaacccttttgagttcaaccctgaggaccccatccctgtctccttctcgcca
gtggacactaacagcacatcaagagacccagtggagaagaaggacgaaacaccttttggg
gtctctgtggctgtgggcctggccgtctccgccgccctcttcctttctgccctcctccta
gtgctcaacaaatgtggacagaggagcaaatttgggatcaaccgccctgctgtgctggcg
ccagaggatgggctggccatgtccctacacttcatgacactgggtggcagttctctttcc
cctactgagggcaaaggctccggactccagggccacatcatggagaacccacagtacttc
agtgatacctgtgtccaccatatcaagcgccaggacatcattctcaagtgggagctaggg
gagggagcctttggaaaggtctttcttgctgagtgctacaaccttctgaatgatcaggac
aagatgctggtggctgtcaaggcactgaaggagacatctgagaatgctcgtcaggacttc
catcgtgaggcagagctgctcaccatgctacagcaccaacacatcgtacgcttctttgga
gtctgcacggagggtggcccattgctcatggtcttcgagtacatgcgccatggggacctc
aaccgtttcctccggtcccacggacctgatgcaaaactgctggctggcggcgaggatgtg
gctcctggtcctttgggccttgggcagcttctggctgtggctagccaggtggctgctggt
atggtgtacctagccagcctgcactttgtgcaccgggacctggccacacgcaactgtctg
gtgggtcagggactagtggtcaagattggagacttcggcatgagcagggacatctacagc
acagactactaccgtgtgggaggtcggaccatgctgcccatccgctggatgcctccagag
agcatcctctaccgcaagttcagcaccgagagtgatgtgtggagcttcggggtggtgctc
tgggagatcttcacctatggaaagcaaccctggtaccagctctccaacactgaggcgatc
gagtgcatcacgcagggccgggagctggagcggccgcgcgcctgccctcctgatgtctac
gccatcatgcgcggctgctggcagcgtgagccgcaacagcgcctcagcatgaaggatgtg
cacgcgcggctgcaggccttggcacaggcgccaccgagttacctggacgttctgggctag

DBGET integrated database retrieval system