KEGG   Rattus norvegicus (rat): 60326Help
Entry
60326             CDS       T01003                                 

Gene name
Kcnv1, Kv8.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily V member 1
  KO
K04934  
potassium channel subfamily V member 1
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNV, Kv8.x
   60326 (Kcnv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q31
AA seq 503 aa AA seqDB search
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCLTVNVGGSRFVLSQQAL
SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY
RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ
HESEQDFSQGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL
NLQLLEILEYVCISWFTGEFILRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG
SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDIYARSIM
EMLRLKGRERASTRSSGGDDFWF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtcaccccgcaaccggccgcttctggactcgtcctcgctggacagtggctcc
ctgacctcgctggactccagcgtcttctgcagcgagggcgaaggggaacccttggctctg
ggggactgccttacggtcaacgtgggaggcagccgcttcgtgctctctcagcaagctctg
tcctgcttcccgcacacgcgcctgggcaaactggccgtggtggtggcctcctaccgccgc
ctgggcgccctggctgcagcccccagccccttggagctttgtgatgatgccaacccggta
gacaacgagtacttcttcgaccgcagctctcaggcattccgttatgtcctacactattat
cgcactggccgcttgcacgtcatggagcagctctgtgcactctcctttcttcaggagatc
cagtactggggcatcgatgaactcagcatcgactcctgctgcagggacagatacttcaga
agaaaggagctgagtgaaactcttgacttcaagaaggacacagatgaccaggaaagtcaa
catgagagtgaacaggacttctcacaaggaccttgtcctaccgtccgacaaaagctctgg
gatattctggagaagcctgggtcttccacagcagcccggatctttggagtgatctccatc
atttttgtggcagtgtccatcgtcaacatggccctgatgtcagctgagctaagctggctc
aacctacagctgctggagattttggagtatgtgtgcatcagttggttcaccggggagttc
attctgcgcttcctgtgtgtgaaagacaggtgccacttcctgaggaaggttccaaacatc
atagacctccttgccatcttgcccttctacataactcttctggtggaaagcctgagcggc
agccacaccacccaagagctggaaaatgtaggacgtctggtccaggttttgaggctcctt
agagctctgcgcatgctgaagctgggaaggcattctacaggattgcgctcacttgggatg
acaatcacccagtgctatgaagaagtcggcctactgctcctgtttctatctgtgggaatt
tctatattttcaacaatagaatactttgcagagcaaagcattcctgatacaaccttcaca
agtgttccttgtgcatggtggtgggccacaacatccatgactacagtaggatatggggac
attagaccagacaccacgacaggcaaaatcgtggccttcatgtgtattctatcaggaatc
cttgtcttggccttgcctattgccattattaatgatcgcttctctgcttgttatttcacc
ttgaaactcaaggaagcagctgtgagacagcgtgaagctctcaagaagcttaccaagaat
atagccactgactcatacattagtgttaacctgagggatatctatgcccggagcatcatg
gagatgcttcgattaaagggcagggagagagcgagtactagaagcagtggtggagatgat
ttctggttttaa

DBGET integrated database retrieval system