KEGG   Rattus norvegicus (rat): 60416Help
Entry
60416             CDS       T01003                                 

Gene name
Pfkp, ATP-PFK, PFK-C, PFK-P
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Thyroid hormone signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    60416 (Pfkp)
   01230 Biosynthesis of amino acids
    60416 (Pfkp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    60416 (Pfkp)
   00030 Pentose phosphate pathway
    60416 (Pfkp)
   00051 Fructose and mannose metabolism
    60416 (Pfkp)
   00052 Galactose metabolism
    60416 (Pfkp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    60416 (Pfkp)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    60416 (Pfkp)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    60416 (Pfkp)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    60416 (Pfkp)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     60416 (Pfkp)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     60416 (Pfkp)
Messenger RNA biogenesis [BR:rno03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     60416 (Pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17q12.2
AA seq 788 aa AA seqDB search
MSDQDSSTSSTSFPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRMGIYTGAKVYFI
YEGYQGMVDGGSNIVEAKWECVSSILQVGGTIIGSARCQAFRSREGRLKAACNLVRLGIT
NLCVIGGDGSLTGANLFRKEWSGLLEELAKNGEIDSDTVKKHAYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEEGWEEEMCLKLSENRARKKRLNIIIVSEGAIDTQNKPITSEKIKELVVTNLGFDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATPETPACVVSLRGNQAVRLPLMEC
VQMTQDVQKAMDERRFDEAVKLRGRSFEGNLNTYKRLAIKEPDDKIPKSNCNVAIINVGA
PAAGMNAAVRSAVRVGIAEGHKMFAIYDGFDGLANGQIKEIGWGDVGGWTGQGGSILGTK
RTLPGKYLEKIAEQMHSKNINALLIIGGFEAYLGLLELAAARNKHEAFCVPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGA
DAAYIFEEQFDIRDLQSNVMHLTEKMKTSIQRGLVLRNENCSVNYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAMEWISAKLKGSHGTGKKFVSDDSICVL
GIQKRDLLFKPVAELRKATDFEHRIPKQQWWLKLRPIMKILAKYEASYDMSDVGKLEPVH
NHGELSAI
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaccaggactcttcgacgtccagcacctcctttccgaagtacctggagcacctc
tctggggatggcaaagccatcggtgtcctgaccagcggcggggatgcccaaggcatgaat
gctgctgtccgtgctgtggtgcgcatgggaatatacacgggggccaaagtgtactttata
tacgagggttaccaaggcatggtggatggaggctccaatattgtggaagccaagtgggag
tgtgtctccagcattctacaagtgggtgggaccatcatcggcagtgcgcgttgccaagcc
ttccgcagccgtgaagggcgtctgaaagccgcctgtaacctggtacgcttgggcataacc
aacctgtgcgtgatcggtggggacggaagtctcacgggagccaacctcttccggaaggag
tggagcggtcttctggaagagctggctaagaatggtgagatcgattcggacacagtgaag
aagcacgcctacctcaacgtggtgggcatggtgggctccattgacaatgacttctgtggc
acagacatgaccatcggtacagattcagctctgcaccgaattattgaagttgttgatgcc
atcatgaccactgcccagagccaccagagaaccttcgtcctggaggtgatggggagacac
tgtggttacttggccttggtgagcgccttggcttgcggtgccgactgggtgttccttcca
gagtctccgccagaggaaggttgggaggaagaaatgtgcctcaaactctccgagaaccgt
gcccgaaagaaaaggctgaatatcatcattgtgtctgaaggagcaatcgacacccaaaat
aagccaatcacctctgagaaaatcaaggagcttgtggtgacaaatttgggctttgacacc
cgggtcaccattcttggacatgtccagagaggagggaccccttctgcatttgacaggatt
ttggccagccgtatgggagtggaggctgtccttgccttgctggaagctacccctgagacc
ccagcctgtgtcgtgtcactgagaggaaatcaagctgtacgcctgcctctgatggagtgc
gtgcaaatgacccaggatgtacagaaagcaatggatgaaaggagatttgatgaagccgta
aaactccgaggaaggagttttgagggcaacctgaacacctacaagcgtcttgccattaag
gagcctgatgacaagatccccaagagcaattgcaatgtagccatcatcaatgtaggggca
cctgccgcaggaatgaatgcagccgtgcgctccgctgttcgggttgggattgcagagggc
cacaagatgttcgcaatctatgacggctttgatggcctcgccaatggccaaatcaaagaa
atcggctggggagatgtcggaggttggacgggacaaggagggtccattcttgggacgaaa
cgcaccctacccggaaagtacttggagaagatcgcagaacagatgcactcgaaaaatatc
aatgcccttctgatcattggcggattcgaggcctacctgggactcctagagctggcagct
gcccggaacaaacatgaggcgttctgtgtccctatggttatggttcctgctactgtctcc
aacaatgtgccaggttctgatttcagcatcggggcagacacggctctgaacactatcaca
gacacgtgcgaccgcataaaacagtcagccagtgggaccaagcgccgggtgttcatcatt
gagaccatgggcggatactgtggctacctggccaacatggggggacttgcagcgggagcc
gatgctgcctacatctttgaagaacaatttgatatccgagatttgcagtccaacgtcatg
cacttgacggagaaaatgaagaccagcatccagaggggccttgtcctcagaaatgaaaac
tgcagtgtaaattacaccacggacttcatctaccagctctactcagaggaagggaaagga
gtgtttgactgcaggaagaacgtgctaggccacatgcagcaggggggagcaccttctcca
ttcgacagaaactttggaaccaaaatatctgccaaagctatggagtggatctcggccaaa
ctgaagggctcccacggcacagggaaaaaatttgttagtgatgattccatttgtgtcctg
ggaattcagaagagagacctcctgtttaaaccagtggcagagctaaggaaggctactgac
tttgagcaccgtatccccaagcaacagtggtggctgaaactgcggccgatcatgaagatc
ttggcaaagtatgaggcaagctatgacatgtcagacgtaggcaagctggagccggtgcat
aaccacggagaactatcagccatctga

DBGET integrated database retrieval system