KEGG   Rattus norvegicus (rat): 60447Help
Entry
60447             CDS       T01003                                 

Gene name
Clock
Definition
clock circadian regulator (EC:2.3.1.48)
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Class
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:rno04728]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:rno04710]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:rno05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p11
AA seq 862 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSETVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEDLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLESLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGVEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMTQRRSSF
SSQSINSQSVGSSLTQPAMSQAANLPIPQGMSQFQLSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNLGSVQLSSGNSNIQQLTPINMQGQV
VPVNQIQSGVNAGHVSTGQHMIQQQTLQSTSTQSQQSVMSGHSQPTSLPNQTPSTLTAPL
YNTMVISQPAAGSMVPIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMLMGQVVTAYPTFATQQQQAQALSVTQQQQQQQQQQQQQQQQQPQQAQQPQSQ
QSSQDQPHPSVQQPAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQH
QQQQLHRHRTDSLTDPSKVQPQ
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgtactcattaaggaactggggtctatg
cttcctggtaatgctagaaagatggacaagtctactgttctacagaagagcattgatttt
ttacgcaaacataaagagatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagacggtaacttcg
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactatctactcacctgctggaaagtgactcctta
acccccgaggacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagacccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaacagtgtatcaacttcaacacataatggtttcgaaggaactatacagcgcaca
cacaggccttcttatgaagatagagtttgtttcgtagctactgtcagattagctacccct
cagttcatcaaggaaatgtgtactgttgaagaaccgaatgaagagttcacatctagacac
agtttagaatggaagtttctatttctagatcacagggcgccgccaatcataggctatctg
ccgtttgaagtcctgggaacatcaggctatgattactatcatgtggacgacctagaaagt
ctggcaaaatgtcatgagcacttaatgcaatatggaaaaggcaaatcatgttactatagg
ttcttgaccaaaggacagcagtggatttggcttcagactcattactatatcacttaccat
cagtggaactcaaggccagagttcatcgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcgttgaggagtctcttcccgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtataaacacagtgagtctcaaggaagca
ctggaaaggttcgatcacagcccaactccttctgcctcctccagaagctcaagaaagtcc
tcgcacacagcagtctcagacccttcctcaacgccgacaaagatccccactgatactagc
actcctcccagaccgcacctgccagctcatgagaagatgacacagcggaggtcatccttc
agtagtcagtccataaactcccagtcagttggttcatcattaacacagccagcgatgtct
caagctgcaaatttaccaatcccacaaggcatgtcacagtttcagctttcagctcagtta
ggagccatgcagcatctcaaagaccagctagagcagcggacacgcatgatagaagcaaat
attcatcggcagcaagaagaactaaggaaaattcaagaacaacttcaaatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggactgaatcttggttctgttcaa
ctttcctctggaaattccaatatccagcaactcacacctataaatatgcaaggccaagtt
gtccctgttaaccagattcagagtggggtgaatgctggccatgtcagcacaggccagcac
atgatccagcagcagactttacaaagtacatcaactcagagtcaacagagtgtaatgagt
ggacacagtcagccaacgtctcttccaaaccagacgccgagcactctgacagccccactg
tacaatacgatggtgatctctcagcctgcggctgggagcatggtcccgattccatccagt
atgccgcagaatagcacccagagtgctacagtcaccacgttcactcaggacagacagata
aggttttctcaaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgtggg
gccgtcatggtgccaagtaccatgcttatgggtcaggtagtgactgcctatcctactttt
gccacacaacagcagcaggcacaggccttgtcagtaacacagcaacagcagcagcagcag
cagcagcagcaacagcagcagcagcagcagccgcagcaggcgcagcagccccagtcacag
cagagttcccaggaccagccgcatccttcagttcagcagccagctcagctgacccagcca
ccacaacagttcttacagacatctcggttgctccatgggaatccttcgacacagctcatc
ctctccgctgcctttccactacaacagagcactttccctccttcgcaccaccagcaacac
cagcaacagcagctccatcggcacaggactgacagcctgactgacccttccaaggtccag
ccacagtag

DBGET integrated database retrieval system