KEGG   Rattus norvegicus (rat): 60447Help
Entry
60447             CDS       T01003                                 

Gene name
Clock
Definition
(RefSeq) clock circadian regulator (EC:2.3.1.48)
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    60447 (Clock)
  Environmental adaptation
   04710 Circadian rhythm
    60447 (Clock)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    60447 (Clock)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     60447 (Clock)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    60447 (Clock)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    60447 (Clock)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p11
AA seq 862 aa AA seqDB search
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSETVTSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEDLKSKNQLEFCCHMLRGTIDPKEPSTYEYVRFIGNFKSLNSVSTSTHNGFEGTIQRT
HRPSYEDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLESLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGVEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMTQRRSSF
SSQSINSQSVGSSLTQPAMSQAANLPIPQGMSQFQLSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNLGSVQLSSGNSNIQQLTPINMQGQV
VPVNQIQSGVNAGHVSTGQHMIQQQTLQSTSTQSQQSVMSGHSQPTSLPNQTPSTLTAPL
YNTMVISQPAAGSMVPIPSSMPQNSTQSATVTTFTQDRQIRFSQGQQLVTKLVTAPVACG
AVMVPSTMLMGQVVTAYPTFATQQQQAQALSVTQQQQQQQQQQQQQQQQQPQQAQQPQSQ
QSSQDQPHPSVQQPAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPPSHHQQH
QQQQLHRHRTDSLTDPSKVQPQ
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcaattgttgacagagatgacagtagt
atttttgatggattggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatcagaaaagaaacgtagagatcagttcaatgtactcattaaggaactggggtctatg
cttcctggtaatgctagaaagatggacaagtctactgttctacagaagagcattgatttt
ttacgcaaacataaagagatcactgcacagtcagatgctagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagagtttacacaattaatgttagaggctcttgatggt
ttttttttagcgatcatgacagatggaagtataatatatgtatctgagacggtaacttcg
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagag
ggagaacattcagaggtttataagatactatctactcacctgctggaaagtgactcctta
acccccgaggacttaaaatcaaaaaatcagttagaattctgttgtcacatgcttcgagga
acaatagacccaaaggagccatccacctatgaatatgtgagatttataggaaattttaaa
tctttaaacagtgtatcaacttcaacacataatggtttcgaaggaactatacagcgcaca
cacaggccttcttatgaagatagagtttgtttcgtagctactgtcagattagctacccct
cagttcatcaaggaaatgtgtactgttgaagaaccgaatgaagagttcacatctagacac
agtttagaatggaagtttctatttctagatcacagggcgccgccaatcataggctatctg
ccgtttgaagtcctgggaacatcaggctatgattactatcatgtggacgacctagaaagt
ctggcaaaatgtcatgagcacttaatgcaatatggaaaaggcaaatcatgttactatagg
ttcttgaccaaaggacagcagtggatttggcttcagactcattactatatcacttaccat
cagtggaactcaaggccagagttcatcgtttgtactcacactgtagtaagttatgcagaa
gttagggctgaaagacggcgagaacttggcgttgaggagtctcttcccgagacagctgct
gacaaaagccaagattctgggtctgacaatcgtataaacacagtgagtctcaaggaagca
ctggaaaggttcgatcacagcccaactccttctgcctcctccagaagctcaagaaagtcc
tcgcacacagcagtctcagacccttcctcaacgccgacaaagatccccactgatactagc
actcctcccagaccgcacctgccagctcatgagaagatgacacagcggaggtcatccttc
agtagtcagtccataaactcccagtcagttggttcatcattaacacagccagcgatgtct
caagctgcaaatttaccaatcccacaaggcatgtcacagtttcagctttcagctcagtta
ggagccatgcagcatctcaaagaccagctagagcagcggacacgcatgatagaagcaaat
attcatcggcagcaagaagaactaaggaaaattcaagaacaacttcaaatggtccatggt
caagggctacagatgtttttgcagcaatcaaaccctggactgaatcttggttctgttcaa
ctttcctctggaaattccaatatccagcaactcacacctataaatatgcaaggccaagtt
gtccctgttaaccagattcagagtggggtgaatgctggccatgtcagcacaggccagcac
atgatccagcagcagactttacaaagtacatcaactcagagtcaacagagtgtaatgagt
ggacacagtcagccaacgtctcttccaaaccagacgccgagcactctgacagccccactg
tacaatacgatggtgatctctcagcctgcggctgggagcatggtcccgattccatccagt
atgccgcagaatagcacccagagtgctacagtcaccacgttcactcaggacagacagata
aggttttctcaaggtcagcaacttgtgaccaaattagtgactgctcctgtagcttgtggg
gccgtcatggtgccaagtaccatgcttatgggtcaggtagtgactgcctatcctactttt
gccacacaacagcagcaggcacaggccttgtcagtaacacagcaacagcagcagcagcag
cagcagcagcaacagcagcagcagcagcagccgcagcaggcgcagcagccccagtcacag
cagagttcccaggaccagccgcatccttcagttcagcagccagctcagctgacccagcca
ccacaacagttcttacagacatctcggttgctccatgggaatccttcgacacagctcatc
ctctccgctgcctttccactacaacagagcactttccctccttcgcaccaccagcaacac
cagcaacagcagctccatcggcacaggactgacagcctgactgacccttccaaggtccag
ccacagtag

DBGET integrated database retrieval system