KEGG   Rattus norvegicus (rat): 60581Help
Entry
60581             CDS       T01003                                 

Gene name
Acaca, ACC1, Acac
Definition
acetyl-CoA carboxylase alpha (EC:6.4.1.2 6.3.4.14)
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    60581 (Acaca)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    60581 (Acaca)
   00640 Propanoate metabolism
    60581 (Acaca)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    60581 (Acaca)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    60581 (Acaca)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    60581 (Acaca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    60581 (Acaca)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     60581 (Acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     60581 (Acaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q26
AA seq 2345 aa AA seqDB search
MDEPSPLAKTLELNQHSRFIIGSVSEDNSEDEISNLVKLDLEEKEGSLSPASVSSDTLSD
LGISALQDGLAFHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASPAEFVTRFGGNKVIEKV
LIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGG
ANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALG
DKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAA
EEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQ
ILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAG
TVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYG
VSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYF
SVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETE
SFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGALHVADVNLRNSISNFLHSLERGQVL
PAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVVIMNGSCVEVDVHRLSDGGLLLSYDGS
SYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSAGKLIQYIVEDGGHVFAGQCYAE
IEVMKMVMTLTAVESGCIHYVKRPGAALDPGCVIAKMQLDNPSKVQQAELHTGSLPQIQS
TALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQD
IMTSVSGRIPLNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSEREVF
FMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKCVFALREENKSDM
NTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDELLNILTELTQLSKTTNAKVALRA
RQVLIASHLPSYDVRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYHS
NQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMS
FASNLNHYGMTHVASVSDVLLDNAFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFCDSPP
QSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIEDDRLAAMFREFTQQNKATLVE
HGIRRLTFLVAQKDFRKQVNCEVDQRFHREFPKFFTFRARDKFEEDRIYRHLEPALAFQL
ELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEY
LQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGS
RLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAY
GDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIKLWESMSTQAF
LPSPPLPSDILTYTELVLDDQGQLVHMNRLPGGNEIGMVAWKMSLKSPEYPDGRDVIVIG
NDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVDS
EDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRGSG
MIAGESSLAYDEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGRE
VYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKNVHSSVPLLNSKDPIDR
IIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRARLGGI
PVGVVAVETRTVELSVPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNREGLPLM
VFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWVVIDPTIN
PRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGTPELSPTER
KELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSRTFFYWRLRR
LLLEDLVKKKIHSANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLVEWLEKQLTEE
DGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQRAEVVRILSTM
DSPST
NT seq 7038 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaccatctccgttggccaaaaccctggagctgaaccagcactcccgattcata
attgggtccgtgtctgaagacaactcagaagatgagatcagtaacctggtaaagctggac
ctagaggagaaggagggctccctgtcaccagcctctgtcagctcagatacactttctgat
ttgggaatctctgccttacaggatggtttggcctttcacatgaggtccagcatgtccggc
ttgcacctagtaaaacaaggtcgagacagaaagaaaatagactctcaacgagatttcact
gtggcttcgccagcagaatttgttactcgttttgggggaaataaagtgattgagaaggtt
cttatcgccaacaatggtattgcagcagtgaaatgcatgcgatctatccggcggtggtct
tatgaaatgttccgcaatgaacgtgccatccggtttgttgtcatggttacacccgaagac
cttaaagccaatgcagaatacattaagatggcggatcactatgttccagtgcctggagga
gcaaacaacaacaattatgcaaatgtggaattgattcttgatattgcgaaaaggatacct
gtacaggcagtgtgggctggctggggtcatgcctccgagaaccccaagctcccggagcta
ctcttaaaaaatggcattgctttcatgggccctccgagtcaggccatgtgggcgttgggg
gataagattgcatcgtctattgtggctcaaactgcaggtatccccactcttccctggagt
ggcagtggtcttcgagtggattggcaagaaaatgatttttcgaaacgcatcttaaatgtt
ccacaggatctgtatgagaaaggctatgtgaaggatgtggatgatggactgaaggcagcc
gaggaggttggctatccagtgatgatcaaggcctcagagggaggaggagggaagggaatc
agaaaagttaacaatgcagatgacttccctaacctcttcagacaggttcaagctgaagtc
cctggatcacctatatttgtaatgagattagcaaaacagtctcgtcatctggaggtccag
attctggcggatcagtatggcaatgcaatttctttgtttggtcgtgactgctctgtacaa
cgcaggcatcagaagatcattgaagaagctcctgctgctattgctaccccagcagtattt
gaacacatggaacagtgtgctgtaaaacttgccaaaatggttggttatgtgagcgctggg
actgtggaatacttgtacagccaggacggaagcttctacttcttggaactgaaccctcgg
ctacaggttgaacatccttgtacagagatggtggctgatgtcaatcttcctgcagcacag
ctccagattgccatggggatccctctatttaggatcaaggatattcgtatgatgtatggg
gtatctccttggggtgatgctcccattgattttgaaaattctgctcatgttccttgccca
aggggccatgtgattgctgctcggatcaccagtgaaaacccagatgaggggtttaagccc
agctctggaacagttcaggaacttaattttcgcagcaataagaatgtttggggttatttc
agtgttgctgctgctgggggacttcatgaatttgctgattctcagttcggtcactgcttt
tcctggggagaaaacagagaagaagcaatttcaaatatggtggtggcattgaaggagctg
tctattcggggtgactttcgaactacagtagaatacctcatcaagctgctggagacagaa
agctttcagttgaacagaatcgacactggctggctggacagactgattgcagagaaagtg
caggcagagcgtcctgacaccatgttgggagttgtgtgtggggctcttcatgtggcagat
gtgaacctgagaaatagcatctctaacttccttcactccttagagaggggtcaagtcctt
cctgctcacacacttctgaacacagtagatgttgaacttatctatgaaggaatcaaatat
gtacttaaggtgactcggcagtctcccaactcctacgtggtgataatgaacggctcgtgt
gtggaagtggacgtgcaccggctgagtgatggtggactgctcttgtcctacgatggcagc
agttacaccacatacatgaaggaggaggtagacagataccgaatcacaattggcaataaa
acctgtgtgtttgagaaggaaaatgacccgtctgtaatgcgctccccgtctgctgggaag
ttaatccagtatattgtggaagatggaggccatgtgtttgctggccagtgctatgcagag
attgaggtaatgaagatggtaatgactttgacagctgtagaatctggctgcatccattat
gtcaagcgacctggagcagcacttgacccaggctgtgtgatagccaaaatgcagctggac
aatcccagtaaagttcaacaggctgagcttcacacgggcagtctgccccagatccagagc
acagctctccgaggcgaaaagctccatcgagttttccactatgtcctggataacctggtc
aatgtgatgaatggatactgccttccagaccctttcttcagcagcaaggtaaaggactgg
gtagaacggttaatgaagactctgagagacccctccctgcctcttctagaattgcaggat
atcatgaccagtgtctctggccggatccccctcaacgtggagaagtctattaagaaggaa
atggctcagtatgctagcaacatcacatcggtcctgtgtcagtttcccagccagcagatt
gccaacatcctagatagtcatgcagctacactgaaccggaaatcggagcgggaagtcttc
ttcatgaacacccagagcattgtccagctggtgcagaggtaccgaagtggcatccgtggc
cacatgaaggctgtggtgatggatctgctccggcagtacctgcgggtggagacacagttt
cagaatggccactacgacaaatgtgtattcgcccttcgggaagagaacaaaagtgacatg
aacaccgtactgaactacatcttctcccacgcccaggtcaccaagaagaatctcctggtg
acaatgcttattgatcagttgtgtggccgggaccctacacttactgatgagctgctaaac
atcctcacagagctaactcagctcagcaaaaccaccaacgccaaagtggcactgcgggct
cgccaggttcttattgcctcccatttgccatcgtacgacgttcgccataaccaagtagag
tccatcttcttatcagccatcgacatgtatggacaccagttttgcattgagaacctgcag
aaactcatcctatcagaaacatctattttcgatgtcctcccaaactttttttaccacagc
aaccaggtggtgaggatggcggctctggaggtatatgttcgaagagcttatatcgcctat
gagctcaacagtgtacagcatcgccagcttaaggacaacacctgtgtggtagaatttcag
ttcatgctgcccacatctcatccaaacagagggaacatccccacgctaaacagaatgtcc
tttgcctccaacctcaaccactacggcatgactcatgtagctagtgtcagcgatgttctg
ttggacaacgccttcacaccaccttgtcaacgcatgggcgggatggtctctttccggacc
tttgaagatttcgtcaggatctttgatgaagtaatgggctgcttctgcgactccccaccc
caaagccccacattcccagagtccggtcacacttcactctatgatgaggacaaggtcccc
agggacgaaccaatacatattctgaatgtggctatcaagactgatggcgatattgaggat
gacaggcttgcagctatgttcagagagttcacccaacagaataaagctactctggttgag
catgggatccggcgacttacgttcctagttgcacaaaaggatttcagaaaacaagtcaac
tgtgaggtggatcagagatttcatagagaattccccaaatttttcacattccgagcaagg
gataagtttgaggaggaccgcatttatcgacatctggagcctgctctggctttccagtta
gagctgaaccggatgagaaattttgaccttactgccattccatgcgctaatcacaagatg
cacctgtaccttggggctgctaaggtggaagtaggcacagaagtgactgactacaggttc
tttgttcgtgcgatcatcaggcactctgatctggtcacgaaggaagcttcttttgaatat
ctacaaaatgaaggagagcgactgctcctggaagccatggatgaattggaagttgctttc
aataacacaaatgttcgcacagactgtaaccatatattcctcaactttgtgcccacagtc
atcatggacccatcaaagattgaagaatctgtgcggagcatggtaatgcgctatggaagc
cggctgtggaaattgcgggtcctccaggcagaactgaaaatcaacattcgcctgacaaca
actggaaaagcgattcccatccgcctcttcctgacaaacgagtctggctactacttggac
atcagcctgtataaggaagtgactgactccaggacagcacagatcatgtttcaggcgtat
ggagacaagcagggaccactgcatggaatgttaatcaatactccgtatgtgaccaaagac
cttcttcaatcaaagaggtttcaggcacagtccttgggaacaacgtatatatatgatatc
ccagagatgtttcggcagtcgctcatcaagctctgggagtccatgtccactcaagcattt
cttccttcaccccctttgccttccgacatactgacgtatactgaactggtgttggatgat
caaggccagcttgtccatatgaacagacttccaggaggaaacgagattggcatggtagcc
tggaaaatgagccttaaaagccctgaatatccagatggccgagatgtcattgtcatcggc
aatgacattacatatcggattggctcctttgggcctcaggaagatttgctgtttctcaga
gcttctgaacttgccagagcagaaggcatcccacgcatctacgtagcagccaacagtgga
gctagaattggactggcagaagaaatccgtcatatgttccacgtggcctgggtagactct
gaggatccttacaagggatacaagtatttatatctgacaccccaggattataaaagagtg
agtgctctcaattctgtccactgtgaacatgtggaagatgaaggagaatccaggtacaag
ataacagacattatcgggaaagaagaaggacttggagcagagaaccttcggggttctgga
atgattgctggggaatcctcattggcttatgatgagatcatcaccatcagcctggttaca
tgccgggccattggtattggggcttaccttgtccggctgggacaaagaaccatccaggtt
gagaactctcacttaattctaacaggagccggtgccctcaacaaagtccttggtcgggaa
gtatacacctccaacaatcagcttgggggcatccagataatgcacaacaacggagttacc
cattgcactgtttgtgatgactttgagggagtgttcacagtcttacactggctgtcatac
atgcctaagaacgtgcacagttcagttcctctcctgaattccaaggatcctatagataga
atcatcgagtttgttcccacaaaggccccgtatgatcctcggtggatgctggcaggccgt
cctcacccaacccagaaaggccaatggttgagtggattttttgattatggctctttctca
gaaatcatgcagccctgggcgcagaccgtggtagttggcagagccaggttggggggaata
cctgtgggagtagttgctgtagaaacccgaaccgtggagctcagtgtaccagctgatcct
gcaaacctggattctgaagccaagataatccagcaggccggccaagtttggtttccagac
tctgcatttaagacctatcaagctatcaaggactttaaccgtgaagggctacctctaatg
gtctttgccaactggagaggcttctctggtgggatgaaagatatgtatgaccaggtgctc
aagtttggtgcttatattgtggatggcttgcgggaatgttcccagcctgtgatggtctac
attcccccacaggctgagcttcggggtggttcttgggttgtgatcgacccaaccatcaat
cctcggcacatggagatgtatgctgaccgggaaagcaggggatccgttctggaaccagaa
gggacagtagaaatcaaattccgcaaaaaggatctggtgaaaaccatgcgtcgcgtagac
ccagtctacatccgcttggctgagcgactgggcaccccagagctaagccccactgagcgg
aaggagctggagagcaagttgaaggagcgggaggagttcctaattcccatttaccatcag
gtagctgtgcagtttgctgacttgcacgacaccccaggccggatgcaggagaagggtgtc
attaatgatatcttagattggaaaacatcccgcaccttcttctactggcgactgaggcgt
ctcctgctggaagacctggtcaagaagaaaatccacagtgccaaccctgagctgaccgat
ggccagatccaggccatgttgagacgctggtttgtggaagtggaaggcacagtgaaggct
tacgtctgggacaataataaggatctggtggaatggctggagaagcagctgacagaggaa
gatggtgtccgctctgtgatagaggagaacatcaaatacatcagcagggactatgtcctc
aagcagatccgcagcttggtgcaggccaatccagaagttgccatggactccatcgtccac
atgacccagcacatctcccccactcagcgagcagaggttgtaaggatcctttccactatg
gactccccttctacgtag

DBGET integrated database retrieval system