KEGG   Rattus norvegicus (rat): 63849Help
Entry
63849             CDS       T01003                                 

Gene name
Mmp8
Definition
matrix metallopeptidase 8 (EC:3.4.24.34)
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     63849 (Mmp8)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M10
   63849 (Mmp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q11
AA seq 466 aa AA seqDB search
MLHLKTLPFLFFFHTQLATALPVPPEHLEEKNMKTAENYLRKFYHLPSNQFRSARNATMI
AEKLKEMQRFFGLPETGKPDAATIEIMEKPRCGVPDSGDFLLTPGSPKWTHTNLTYRIIN
HTPQMSKAEVKTEIEKAFKIWSVPSTLTFTETLEGEADINIAFVSRDHGDNSPFDGPNGI
LAHAFQPGRGIGGDAHFDSEETWTQDSKNYNLFLVAAHEFGHSLGLSHSTDPGALMYPNY
AYREPSTYSLPQDDINGIQTIYGPSDNPVQPTGPSTPTACDPHLRFDAATTLRGEIYFFK
DKYFWRRHPQLRTVDLNFISLFWPFLPNGLQAAYEDFDRDLVFLFKGRQYWALSAYDLQQ
GYPRDISNYGFPRSVQAIDAAVSYNGKTYFFVNNQCWRYDNQRRSMDPGYPTSIASVFPG
INCRIDAVFQQDSFFLFFSGPQYFAFNLVSRRVTRVARSNLWLNCP
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacctgaagacacttccatttctgttcttcttccacacacagcttgccacagcc
ctcccagtgcctccagaacacctggaagagaaaaatatgaaaactgctgagaattaccta
cgaaaattctaccacttaccaagcaatcagttccggtctgcaaggaatgccactatgatt
gccgagaagcttaaggagatgcagcgcttcttcggcttgcccgagacagggaagccagat
gcagctacaatagagataatggaaaagcctcgctgtggagtgcccgactctggtgatttc
ttgctaactccgggaagccccaagtggacacacactaacctgacctacaggattataaac
cataccccacagatgtcaaaggctgaagtgaaaacagaaatcgagaaagcttttaaaatc
tggagtgtgccatcaaccctgaccttcactgagaccttagagggagaagcagacatcaac
attgctttcgtctcaagagaccatggtgacaattctccatttgatggacccaatggaatc
cttgcccatgcctttcaaccaggccggggtattggaggagatgcacattttgattcagaa
gaaacgtggactcaagactccaagaattacaacctgtttctcgtggctgctcatgaattt
ggacattccttgggactctctcactccactgatcctggtgccttgatgtacccaaactat
gcttacagagaacccagcacctattcactacctcaagatgatatcaatggaattcagaca
atctatggaccttcagacaaccctgtccaacctactggacccagcacgcccacagcctgt
gacccccacctgagatttgatgctgccaccacactccgtggggagatttacttctttaaa
gacaagtacttctggagacggcatccccagctgagaacagttgacctcaatttcatatct
ctgttctggcccttcctacctaatggtcttcaggctgcttatgaagactttgatagagac
ctagttttcttatttaaaggcagacagtactgggctctaagtgcctatgacttgcagcaa
ggttaccccagagatatatccaactatggattcccaaggagtgtccaagccattgatgca
gctgtttcctataacgggaagacatacttcttcgtaaacaaccaatgctggagatacgac
aatcaaagaagatccatggatccaggttaccccactagcatagcaagcgtgttcccagga
ataaactgtagaattgatgcagttttccagcaggattccttcttcctcttcttcagtgga
ccacaatattttgcatttaatcttgtcagtcgcagagtcactagagttgcaagaagcaat
ttatggcttaactgtccatag

DBGET integrated database retrieval system