KEGG   Rattus norvegicus (rat): 63867Help
Entry
63867             CDS       T01003                                 

Gene name
Ugt2a1, Ugt2a1p
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    63867 (Ugt2a1)
   00053 Ascorbate and aldarate metabolism
    63867 (Ugt2a1)
   00500 Starch and sucrose metabolism
    63867 (Ugt2a1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    63867 (Ugt2a1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    63867 (Ugt2a1)
   00860 Porphyrin and chlorophyll metabolism
    63867 (Ugt2a1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    63867 (Ugt2a1)
   00982 Drug metabolism - cytochrome P450
    63867 (Ugt2a1)
   00983 Drug metabolism - other enzymes
    63867 (Ugt2a1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    63867 (Ugt2a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     63867 (Ugt2a1)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   63867 (Ugt2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
14p21
AA seq 527 aa AA seqDB search
MLKNILLWSLQLSLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALF
ITPSVSPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHL
VSRGICDGVLKNEKLMTKLQRGKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVE
KHCGKVPFPPSYVPAILSELTDQMSFADRVRNFISYRMQDYMFETLWKQWDSYYSKALGR
PTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEH
GVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKIPATLGSNTRLFDWIPQNDL
LGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTS
ADLLSAVRAVINEPFYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHD
LSWFQYHSLDVIGFLLACMASAILLVIKCCLFVFQKIGKTXKKNKRD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaacattctactgtggtctcttcagctaagtctcctaggaatgagtcttggc
gggaatgttctcatctggccaatggaaggcagtcactggctaaatgttaagatcataata
gacgaactcctaaggaaagagcataacgtgactgtccttgttgcatccggggcccttttc
atcacaccgtcggtcagcccatctctgacattcgaaatatatccagtgcccttcggcaag
gaaaaaatcgaaagcgtgatcaaggactttgttttgacgtggctggaaaacaggccgtct
ccttcaactatctggactttctataaggaaatggccaaagtcatcgaggagttccacttg
gtgtccagagggatctgtgatggcgttcttaagaatgaaaagctgatgaccaagctgcag
agaggaaagtttgaagtactgttgtcagacccagtatttccgtgtggcgatatcgtagct
ttaaaactggggattccatttatctattccttgcggttttctcctgcctccacagtggaa
aagcactgtggaaaagtcccgtttcctccttcctatgttcctgcaatcttgtcagaactc
acagaccagatgtccttcgctgaccgagtaaggaactttatctcctaccgaatgcaggac
tacatgtttgaaactctttggaagcaatgggattcctattacagtaaagccttaggaaga
cccaccacactgtgcgagactatggggaaagctgagatttggctaatgcgaacatattgg
gattttgaatttcctcgtccatatttgcctaattttgagtttgtgggaggactgcactgc
aaacctgccaagcctttgcctaaggaaatggaagagtttgtccagacctcaggggaacat
ggtgttgtggtgttttctttggggtcaatggtcaaaaacctgacagaagaaaaggccaat
ctcattgcctcagcccttgcccagattcctcagaaggttttgtggcgatacaaaggaaag
ataccagccacattaggatccaatacgagattgtttgactggattcctcagaatgatctt
cttggacatcccaaaaccagagcttttatcacccatggtggaacaaatggaatctatgag
gccatttaccacgggatcccgatggtgggagttcccatgttcgctgatcagcctgacaac
atagctcacatgaaggctaaaggagcagctgtggaggtgaacatgaacacgatgacgagt
gcagatctgctcagtgctgtgagagcagtcatcaatgagccattttataaagagaatgcc
atgagactatcaagaattcaccacgatcagccagtgaagcccctggacagagccgtcttc
tggattgagtttgtcatgcgtcacaaaggagccaagcaccttcgtgtggcagcgcatgac
ctcagctggtttcagtaccactctctagatgtgattgggttcctgctggcttgtatggca
tctgccatattattggttataaaatgttgtttatttgtatttcaaaaaattggtaagaca
ngaaagaagaataaaagggactag

DBGET integrated database retrieval system