KEGG   Rattus norvegicus (rat): 63879Help
Entry
63879             CDS       T01003                                 

Gene name
Xiap, Api3, Birc4, riap3
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
rno  Rattus norvegicus (rat)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    63879 (Xiap)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    63879 (Xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    63879 (Xiap)
  Cellular commiunity
   04510 Focal adhesion
    63879 (Xiap)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    63879 (Xiap)
   05222 Small cell lung cancer
    63879 (Xiap)
  Infectious diseases
   05166 HTLV-I infection
    63879 (Xiap)
   05145 Toxoplasmosis
    63879 (Xiap)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    63879 (Xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq11
AA seq 496 aa AA seqDB search
MTFNSFEGSRTVVPADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAVDRWQYGDSAVGRHRRISPNCRFINGFYFENGATQSTSPGIQNGQYKSENC
VGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPDYAHLS
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLGESVVRTAEKTPS
VTKKIDDTIFQNPMVQEAIRMGFNFKDIKKTMEEKLQTSGSNYLSLEVLIADLVSAQKDN
SQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCCTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctagaactgttgtacctgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagcagcagt
cctgtttcagcatcaacattggcgcgagcggggtttctctacactggtgaaggagacacc
gtgcagtgtttcagttgtcacgcggcagtagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaac
ggtgccacacagtctacatctcctggcatccaaaatggccagtacaaatctgaaaactgt
gtgggaaacagaaatcattttgctcttgacaggccgtcggagactcatgcagattatctc
ctgagaactggacaggttgtagatatttcagataccatatacccgaggaacccggccatg
tgtagtgaagaagccagactgaagacgtttcagaactggccagactatgcccatttaagc
cccagagagttagctagtgctggactctactacacggggattgatgatcaagtgcaatgc
ttttgttgtggtggaaaactgaaaaattgggaaccctgtgaccgtgcctggtcagagcac
aggagacactttcccaactgcttcttcgttttgggccggaatgttaatgttcgaagtgag
tctggtgtgagttcagataggaatttcccaaattcaacaaattctccaagaaatccagcc
atggcagaatatgacgcacggatcgttacttttggaacatggctatactcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgct
aagtggtatccagggtgtaaatatctattggatgagaagggacaagaatatataaataat
attcatttaacccattcacttggggaatctgtggtaagaactgctgaaaaaacaccatca
gtaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggattcaacttcaaggacatcaagaaaacaatggaagaaaagctccaaacatctggg
agcaactatctatcacttgaggttctgattgcagatcttgtgagtgctcagaaagataat
tcgcaggatgagtcaagtcagacttcattgcagaaagacatcagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatagtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcggaagcagttgacaaatgt
cccatgtgctgcacagtcattacgttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system