KEGG   Rattus norvegicus (rat): 63879Help
Entry
63879             CDS       T01003                                 

Gene name
Xiap, Api3, Birc4, riap3
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04064  NF-kappa B signaling pathway
rno04120  Ubiquitin mediated proteolysis
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04510  Focal adhesion
rno04621  NOD-like receptor signaling pathway
rno05145  Toxoplasmosis
rno05166  HTLV-I infection
rno05200  Pathways in cancer
rno05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    63879 (Xiap)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    63879 (Xiap)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    63879 (Xiap)
   04215 Apoptosis - multiple species
    63879 (Xiap)
   04217 Necroptosis
    63879 (Xiap)
  Cellular community - eukaryotes
   04510 Focal adhesion
    63879 (Xiap)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    63879 (Xiap)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    63879 (Xiap)
   05222 Small cell lung cancer
    63879 (Xiap)
  Infectious diseases
   05166 HTLV-I infection
    63879 (Xiap)
   05145 Toxoplasmosis
    63879 (Xiap)
  Drug resistance
   01524 Platinum drug resistance
    63879 (Xiap)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     63879 (Xiap)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    63879 (Xiap)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    63879 (Xiap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 Carbpep_Y_N SH2_2 DUF2039
Motif
Other DBs
NCBI-GeneID: 63879
NCBI-ProteinID: NP_071567
RGD: 620692
Ensembl: ENSRNOG00000006967
UniProt: Q9R0I6
Position
Xq35
AA seq 496 aa AA seqDB search
MTFNSFEGSRTVVPADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAVDRWQYGDSAVGRHRRISPNCRFINGFYFENGATQSTSPGIQNGQYKSENC
VGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPDYAHLS
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLGESVVRTAEKTPS
VTKKIDDTIFQNPMVQEAIRMGFNFKDIKKTMEEKLQTSGSNYLSLEVLIADLVSAQKDN
SQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCCTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctagaactgttgtacctgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagcagcagt
cctgtttcagcatcaacattggcgcgagcggggtttctctacactggtgaaggagacacc
gtgcagtgtttcagttgtcacgcggcagtagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaac
ggtgccacacagtctacatctcctggcatccaaaatggccagtacaaatctgaaaactgt
gtgggaaacagaaatcattttgctcttgacaggccgtcggagactcatgcagattatctc
ctgagaactggacaggttgtagatatttcagataccatatacccgaggaacccggccatg
tgtagtgaagaagccagactgaagacgtttcagaactggccagactatgcccatttaagc
cccagagagttagctagtgctggactctactacacggggattgatgatcaagtgcaatgc
ttttgttgtggtggaaaactgaaaaattgggaaccctgtgaccgtgcctggtcagagcac
aggagacactttcccaactgcttcttcgttttgggccggaatgttaatgttcgaagtgag
tctggtgtgagttcagataggaatttcccaaattcaacaaattctccaagaaatccagcc
atggcagaatatgacgcacggatcgttacttttggaacatggctatactcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgct
aagtggtatccagggtgtaaatatctattggatgagaagggacaagaatatataaataat
attcatttaacccattcacttggggaatctgtggtaagaactgctgaaaaaacaccatca
gtaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggattcaacttcaaggacatcaagaaaacaatggaagaaaagctccaaacatctggg
agcaactatctatcacttgaggttctgattgcagatcttgtgagtgctcagaaagataat
tcgcaggatgagtcaagtcagacttcattgcagaaagacatcagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatagtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcggaagcagttgacaaatgt
cccatgtgctgcacagtcattacgttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system