KEGG   Rattus norvegicus (rat): 63879Help
Entry
63879             CDS       T01003                                 

Gene name
Xiap, Api3, Birc4, riap3
Definition
X-linked inhibitor of apoptosis
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
rno  Rattus norvegicus (rat)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:rno04120]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:rno04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:rno04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:rno04510]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:rno05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:rno05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
Xq11
AA seq 496 aa AA seqDB search
MTFNSFEGSRTVVPADTNKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VQCFSCHAAVDRWQYGDSAVGRHRRISPNCRFINGFYFENGATQSTSPGIQNGQYKSENC
VGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKTFQNWPDYAHLS
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSE
SGVSSDRNFPNSTNSPRNPAMAEYDARIVTFGTWLYSVNKEQLARAGFYALGEGDKVKCF
HCGGGLTDWKPSEDPWEQHAKWYPGCKYLLDEKGQEYINNIHLTHSLGESVVRTAEKTPS
VTKKIDDTIFQNPMVQEAIRMGFNFKDIKKTMEEKLQTSGSNYLSLEVLIADLVSAQKDN
SQDESSQTSLQKDISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKC
PMCCTVITFKQKIFMS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctagaactgttgtacctgcagacaccaataaggat
gaagaatttgtagaagagtttaatagattaaaaacatttgctaacttcccaagcagcagt
cctgtttcagcatcaacattggcgcgagcggggtttctctacactggtgaaggagacacc
gtgcagtgtttcagttgtcacgcggcagtagatagatggcagtatggagactcagctgtt
ggaagacacaggagaatatccccaaattgcagatttatcaatggtttttattttgaaaac
ggtgccacacagtctacatctcctggcatccaaaatggccagtacaaatctgaaaactgt
gtgggaaacagaaatcattttgctcttgacaggccgtcggagactcatgcagattatctc
ctgagaactggacaggttgtagatatttcagataccatatacccgaggaacccggccatg
tgtagtgaagaagccagactgaagacgtttcagaactggccagactatgcccatttaagc
cccagagagttagctagtgctggactctactacacggggattgatgatcaagtgcaatgc
ttttgttgtggtggaaaactgaaaaattgggaaccctgtgaccgtgcctggtcagagcac
aggagacactttcccaactgcttcttcgttttgggccggaatgttaatgttcgaagtgag
tctggtgtgagttcagataggaatttcccaaattcaacaaattctccaagaaatccagcc
atggcagaatatgacgcacggatcgttacttttggaacatggctatactcagttaacaag
gagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtgaagtgcttt
cactgtggaggagggctcacggattggaagccaagtgaagacccttgggaacagcatgct
aagtggtatccagggtgtaaatatctattggatgagaagggacaagaatatataaataat
attcatttaacccattcacttggggaatctgtggtaagaactgctgaaaaaacaccatca
gtaactaaaaaaatcgatgataccatcttccagaatcctatggtgcaagaagctatacga
atgggattcaacttcaaggacatcaagaaaacaatggaagaaaagctccaaacatctggg
agcaactatctatcacttgaggttctgattgcagatcttgtgagtgctcagaaagataat
tcgcaggatgagtcaagtcagacttcattgcagaaagacatcagtactgaagagcagcta
aggcgcctacaagaggagaagctttgcaaaatctgtatggatagaaatattgctatagtt
tttgttccttgtggacatctggtcacttgtaaacagtgtgcggaagcagttgacaaatgt
cccatgtgctgcacagtcattacgttcaagcaaaaaatttttatgtcttaa

DBGET integrated database retrieval system