KEGG   Rattus norvegicus (rat): 64026Help
Entry
64026             CDS       T01003                                 

Gene name
Casp7
Definition
(RefSeq) caspase 7 (EC:3.4.22.60)
  KO
K04397  
caspase 7 [EC:3.4.22.60]
Organism
rno  Rattus norvegicus (rat)
Pathway
Apoptosis
Apoptosis - multiple species
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Pertussis
Legionellosis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    64026 (Casp7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    64026 (Casp7)
   04215 Apoptosis - multiple species
    64026 (Casp7)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    64026 (Casp7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    64026 (Casp7)
  Infectious diseases
   05133 Pertussis
    64026 (Casp7)
   05134 Legionellosis
    64026 (Casp7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     64026 (Casp7)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   64026 (Casp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q55
AA seq 303 aa AA seqDB search
MTDDQDCAAELEMADSSTEDGVDAKPDRSTIISSLLWKKKKNASMCPVSTTRDRVPTYLY
RMDFEKMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKCFRSLGFEVTVYNDCSCAKMQ
DLLRRASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FGR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgatcaggactgtgctgcagagctggaaatggcagattcttcgacggaagac
ggagttgacgctaagccagaccgctccaccatcatctcatcccttctctggaagaagaag
aaaaatgcctctatgtgccccgtcagtaccacccgggaccgcgtgcccacttacctgtac
cgtatggacttcgagaagatgggcaaatgtatcatcataaataacaagaacttcgacaaa
gcgacaggtatggatgtccggaatgggacggacaaagacgcagaggccctcttcaagtgc
ttccgaagcctgggttttgaagtgaccgtctataatgactgctcttgcgcaaagatgcag
gatctgcttagacgagcctctgaagaggaccacagcaactcagcctgcttcgcctgcgtc
ctgctgagccacggagaagagaatctgatttatgggaaagacggcgtgacaccgataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgctagagaaacccaagctc
ttcttcatccaggcgtgccgagggacggagctggatgacgggatccaggctgactcgggg
cctatcaacgacaccgacgctaatccccgctacaagatcccggtggaagctgactttctc
tttgcttactccacggttccaggctattattcgtggaggaacccaggaaagggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctggagatcatgcag
atcctgaccagggtgaacgacagggtggccagacacttcgagtcccagtctgatgacccc
cgcttcaatgagaagaagcagattccatgtatggtgtccatgctcaccaaagagctctac
tttggccgttga

DBGET integrated database retrieval system