KEGG   Rattus norvegicus (rat): 64152Help
Entry
64152             CDS       T01003                                 

Gene name
Chp1, Chp, Wrch2
Definition
calcineurin-like EF-hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     64152 (Chp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q35
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacacgcctgtacagccgcttcaccagcctggacaaa
ggggagaacggaactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttcttctcagagggagaggatcaggtaaacttc
cgaggattcatgagaactttggctcatttccgacccattgaggataacgaaaagagcaaa
gatgtgaatggaccggaacccctcaacagccggagcaacaaactgcactttgctttcaga
ctttatgacttggataaagatgacaagatctcccgcgatgagctgttacaggtactgcga
atgatggtcggagtgaatatctcagatgagcagctgggcagtattgcagacaggaccatc
caggaggctgaccaagatggagacagtgccatatcttttacagaatttgttaaggttttg
gagaaggtggatgtagaacagaagatgagcatccgatttcttcactaa

DBGET integrated database retrieval system