KEGG   Rattus norvegicus (rat): 64191Help
Entry
64191             CDS       T01003                                 

Gene name
Dhcr7
Definition
7-dehydrocholesterol reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    64191 (Dhcr7)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     64191 (Dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q41
AA seq 471 aa AA seqDB search
MASKSQHNASKAKNHNVKAESQGQWGRAWEVDWFSLVSVIFLLLFAPFIVYYFIMACDQY
SCSLTAPILDVATGRASLADIWAKTPPVTAKAAQLYALWVSFQVLLYSWLPDFCHRFLPG
YVGGVQEGAITPAGIVNKYEVNGLQAWLITHFLWFVNAYLLSWFSPTIIFDNWIPLLWCA
NILGYAVSTFAMIKGYLFPTSAEDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFNGRPG
IVAWTLINLSFAAKQQELYGHVTNSMILVNVLQAIYVLDFFWNETWYLKTIDICHDHFGW
YLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPNALGVLLLGLVGYYIFRMTNHQKDLFRRT
DGHCLIWGKKPKAIECSYTSADGLKHRSKLLVSGFWGVARHFNYTGDLMGSLAYCLACGG
GHLLPYFYIIYMTILLTHRCLRDEHRCANKYGRDWERYVAAVPYRLLPGIF
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaagtcccagcacaacgcttccaaagccaagaatcacaacgtcaaggctgaa
tctcaaggacaatggggccgtgcctgggaagtggactggttctccctggtcagcgtcatt
ttcctgctgctcttcgcaccgttcattgtgtactacttcatcatggcatgtgaccagtac
agctgctcgctgactgcccccatattggacgtagctacaggccgtgcgagtctggcagac
atctgggccaagacaccgcctgtgacagctaaggctgcccaactgtatgccttgtgggtc
agcttccaggtgctgctttactcctggcttcctgacttctgccacagatttctgccaggt
tatgtgggaggcgtccaagaaggtgccataactccagcagggattgtaaataagtatgag
gtgaatgggctgcaagcctggctcattacccacttcctctggtttgtgaacgcttacctc
ctatcctggttctcccccaccatcatctttgacaactggatcccgttgctatggtgtgcc
aacatcctgggctacgctgtgtccacctttgcaatgatcaaggggtacctgttccccacc
agcgccgaagactgcaaattcacaggcaatttcttctacaactacatgatggggattgag
ttcaacccccgcatcggaaagtggtttgacttcaagctgttcttcaatgggcgcccgggg
attgtggcctggactcttatcaacctgtcctttgctgccaagcagcaggagctttatggc
catgtgaccaactccatgattttggtcaatgtcttacaggccatctatgtgttagacttc
ttctggaacgaaacctggtacctgaagaccattgacatctgccatgaccactttggatgg
tacctgggctggggagattgcgtgtggctgccctacctctacacactgcagggcctgtac
ttggtgtaccaccctgtacagctctccacccccaacgccttgggcgtcctgctgctcggc
ctggtgggttactatatcttccgaatgaccaaccatcagaaggacctgttccgccggaca
gatggacactgcctcatctggggcaagaaacccaaggccatcgagtgctcctacacgtca
gccgacgggctgaagcaccgcagcaagctgttggtttcaggcttctggggtgtggcccgc
cacttcaactataccggagacctgatgggcagcctcgcctactgcctggcttgtggcggc
ggccacctcctcccctacttctacatcatctatatgactatcctgcttacccaccgctgc
ctccgtgatgagcaccgctgtgccaacaagtatggccgtgactgggagcgctacgtagcc
gctgtgccctaccgcctgctgcctgggatcttctga

DBGET integrated database retrieval system