KEGG   Rattus norvegicus (rat): 64303Help
Entry
64303             CDS       T01003                                 

Gene name
Pfn1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    64303 (Pfn1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    64303 (Pfn1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    64303 (Pfn1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   64303 (Pfn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q24
AA seq 140 aa AA seqDB search
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgctgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc
gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaatttacaatggatcttcgtaccaagagcaccgggggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system