KEGG   Rattus norvegicus (rat): 64303Help
Entry
64303             CDS       T01003                                 

Gene name
Pfn1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:rno04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:rno04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:rno05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q24
AA seq 140 aa AA seqDB search
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgctgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc
gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaatttacaatggatcttcgtaccaagagcaccgggggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac
tga

DBGET integrated database retrieval system