KEGG   Rattus norvegicus (rat): 64462Help
Entry
64462             CDS       T01003                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase 1, delta
  KO
K08959  
casein kinase 1, delta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Hedgehog signaling pathway
Hippo signaling pathway
Gap junction
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    64462 (Csnk1d)
   04390 Hippo signaling pathway
    64462 (Csnk1d)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    64462 (Csnk1d)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    64462 (Csnk1d)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64462 (Csnk1d)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   64462 (Csnk1d)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    64462 (Csnk1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q32.3
AA seq 415 aa AA seqDB search
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctattcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagacgtgaaaccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcccgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacacaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactccaattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccag
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggaccgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacatacggccaacacctctcctagacccgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system