KEGG   Rattus norvegicus (rat): 64462Help
Entry
64462             CDS       T01003                                 

Gene name
Csnk1d
Definition
(RefSeq) casein kinase 1, delta (EC:2.7.11.1 2.7.11.26)
  KO
K08959  
casein kinase 1, delta [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Hedgehog signaling pathway
Hippo signaling pathway
Gap junction
Circadian rhythm
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    64462 (Csnk1d)
   04390 Hippo signaling pathway
    64462 (Csnk1d)
 Cellular Processes
  Cellular community
   04540 Gap junction
    64462 (Csnk1d)
 Organismal Systems
  Environmental adaptation
   04710 Circadian rhythm
    64462 (Csnk1d)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64462 (Csnk1d)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CK1 group
  CK1 family [OT]
   64462 (Csnk1d)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    64462 (Csnk1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q32.3
AA seq 415 aa AA seqDB search
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggagctgagggtcgggaacaggtaccgactgggccgcaagatcggcagcggctccttc
ggagacatctatctcggtacggacattgctgcaggagaagaagttgccatcaagcttgaa
tgtgtcaaaaccaaacatcctcagctccacattgagagcaagatctacaaaatgatgcag
ggaggagtgggcatccctaccatcagatggtgtggggctgagggggactacaatgtcatg
gtgatggagctactgggacccagcctggaagacctattcaacttctgttcaaggaagttt
agtctcaaaactgttctgttgcttgctgaccaaatgataagtcgtattgagtacattcat
tcgaagaattttatccaccgagacgtgaaaccagataacttcctcatggggctgggaaag
aaaggcaacctggtctacatcattgactttgggctggccaagaagtatcgggatgcccgc
acccaccagcatatcccctatcgagagaacaagaacctcacagggacagcacgctatgcc
tccatcaacacacaccttggcattgaacaatctcgaagggatgacttggagtctctgggg
tacgtgctgatgtacttcaacctgggctctctcccctggcaggggctgaaggccgccacc
aagaggcagaagtatgagaggatcagtgagaagaagatgtccactccaattgaagtgctg
tgcaagggctatccttctgaatttgccacatacctgaatttctgccgttccttacgtttt
gatgacaaacctgactactcctacctgagacagctcttcagaaatctgttccatcgccag
ggcttctcctacgactatgtgttcgactggaacatgctcaaatttggtgccagccgggct
gcagatgatgctgagcgggaacgccgggaccgagaagaacgattaagacactcccggaat
ccagccactcgtggcctcccttctacagcttccggccgtctgcggggaacccaggaagtg
gctcccccaacgccccttacccctacctcacatacggccaacacctctcctagacccgtc
tctggcatggaacgagaacggaaagtgagtatgcggctgcaccgtggggccccagtcaac
gtctcctcatctgatctcacgggccgacaagatacctctcgcatgtccacctcacagatt
cccggtcgggtggcttccagtggtcttcagtctgtcgtgcaccgatga

DBGET integrated database retrieval system