KEGG   Rattus norvegicus (rat): 64621Help
Entry
64621             CDS       T01003                                 

Gene name
Akp3, Alpi2, IAP-2, IAP-II
Definition
alkaline phosphatase 3, intestine, not Mn requiring (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rno00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
9q35
AA seq 562 aa AA seqDB search
MQGAWVLLLLGFRLQLSLSVIPVEEENPAFWNQKAADALNVAKKLQPIQTSAKNLIIFLG
DGMGVPTVTATRILKGQLEGNLGPETPLAMDHFPYMALSKTYSVDRQVPDSASTATAYLC
GVKTNYKTIGVSAAARFDQCNTTFGNEVLSVMYRAKKAGKSVGVVTTTRVQHASPAGTYV
HTVNRNWYGDADMPASALQEGCKDIATQLISNMDINVILGGGRKYMFPAGTPDPEYPNDV
NETGTRLDGKNLVQEWLSKHQGSQYVWNRQELIQKSLDPSVTYLMGLFEPVDTKFEIQRD
PLMDPSLKDMTEAALHVLSRNPKGFYLFVEGGRIDRGHHLGTAYLALTEAVMLDSAIERA
SQLTSEQDTLTIVTADHSHVFSFGGYTLRGTSIFGLAPLNALDGKPYTSILYGNGPGYVG
TGERPNVTDAESHDPSYQQQAAVPVKSETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVM
AFAGCLEPYTDCGLAPPADENRPTTPVQNSTTTTTTTTTTTTTTTTTRVQNSASSLGPAT
GPLALALLAKALMLLLGAPADF
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcgcctgggtgctgctgctgctgggcttcaggctacaactgtcccttagcgtc
attccagtggaggaggagaacccagcattctggaaccagaaggcagccgatgccctgaat
gttgccaagaagctgcagcccattcagacgtcagccaagaacctcatcatcttcctgggt
gatgggatgggggtgcccacagtgacagctactcggatcctaaagggacagttggaaggt
aatctaggacctgagacacctctagccatggaccacttcccatatatggctctgtccaag
acatacagtgtggacagacaggtcccagacagtgcaagcacagccaccgcctacctatgt
ggggtcaagacgaactacaagaccattggtgtgagcgcggcagcacgatttgaccagtgc
aacaccacatttggcaacgaggtcctctctgtgatgtatcgtgccaaaaaagcaggaaaa
tccgtaggcgtggtgaccaccaccagggtgcagcacgcatctccagcaggcacctatgtt
cacactgtgaaccgcaattggtacggggatgcggatatgcctgcctctgcactgcaggag
ggctgcaaggacattgctacacaactcatctccaacatggacattaacgtgatccttggt
gggggccgaaaatacatgtttcctgcaggaaccccagaccctgagtatccgaatgatgtt
aatgagactggaaccagactggacggcaagaacctggtgcaggaatggctgtcaaagcac
cagggttcccagtatgtttggaatcgccaagagctcattcagaagtccctggatccatca
gtgacgtatctcatgggcctctttgagcctgtagacacaaaattcgagattcaacgagac
cccctgatggacccatctctgaaggatatgacagaggcagccctgcatgtgctaagcagg
aaccccaaaggcttctatctatttgtggaggggggccggatcgaccgcggtcaccatctg
ggcacagcttatctggcgctgactgaagctgtgatgctcgactcagccatcgagagggcc
agccagctcactagtgagcaggacactctgaccatagtcactgctgaccactcccatgtc
ttctcctttggtggctacacacttcgagggacctccatctttgggctggctcccctcaat
gctctggatggcaagccctacacctccatcctgtatggcaatggcccaggctatgtcggt
acaggggaaagacccaacgtcaccgatgctgaaagccatgacccatcgtaccagcagcag
gctgctgtgccggtgaagtcggagacccacggtggggaggacgtggctatattcgcacgt
ggcccgcaggcgcacttgctacacggagtgcaggaacagaactacatcgcgcacgtcatg
gccttcgcaggctgcctggagccctacaccgactgtggcctggcgccccctgcagacgag
aacagaccaaccaccccggtccagaacagcaccactaccaccaccaccaccaccaccacc
accaccaccaccactaccacccgggtccagaacagcgccagtagcctgggtccagccacc
ggcccactggccctggcactactggccaaggcgctgatgctactactgggggctcctgct
gatttctaa

DBGET integrated database retrieval system