KEGG   Rattus norvegicus (rat): 64647Help
Entry
64647             CDS       T01003                                 

Gene name
Hist1h2bl, H2b
Definition
histone cluster 1, H2bl
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    64647 (Hist1h2bl)
  Immune diseases
   05322 Systemic lupus erythematosus
    64647 (Hist1h2bl)
  Substance dependence
   05034 Alcoholism
    64647 (Hist1h2bl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64647 (Hist1h2bl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
17q11
AA seq 125 aa AA seqDB search
MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaagtcccgtcccgccccgaagaagggctccaagaaggctgtgacc
aaggcccagaagaaggacggcaaggaacgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggaatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggagagcgtcgcctg
gcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgcctg
ctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcagtcaccaag
tacaccagctccaagtga

DBGET integrated database retrieval system