KEGG   Rattus norvegicus (rat): 64647Help
Entry
64647             CDS       T01003                                 

Gene name
Hist1h2bl, H2b
Definition
(RefSeq) histone cluster 1, H2bl
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    64647 (Hist1h2bl)
  Immune diseases
   05322 Systemic lupus erythematosus
    64647 (Hist1h2bl)
  Substance dependence
   05034 Alcoholism
    64647 (Hist1h2bl)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    64647 (Hist1h2bl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64647 (Hist1h2bl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 64647
NCBI-ProteinID: NP_072173
RGD: 621439
UniProt: Q00715
Position
17p11
AA seq 125 aa AA seqDB search
MPEPAKSRPAPKKGSKKAVTKAQKKDGKERKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGERRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcccgccaagtcccgtcccgccccgaagaagggctccaagaaggctgtgacc
aaggcccagaagaaggacggcaaggaacgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtgcacccggataccggaatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggagagcgtcgcctg
gcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgcctg
ctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggcagtcaccaag
tacaccagctccaagtga

DBGET integrated database retrieval system