KEGG   Rattus norvegicus (rat): 64677Help
Entry
64677             CDS       T01003                                 

Gene name
Srd5a2, S5AR_2
Definition
(RefSeq) steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) (EC:1.3.1.22)
  KO
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    64677 (Srd5a2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    64677 (Srd5a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     64677 (Srd5a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q13
AA seq 254 aa AA seqDB search
MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPS
FVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCI
GNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRI
PRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFK
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgtctgccatcaggtcccggtgctggcaggtagcgccacattggccactatg
gggaccctgatcctgtgcttagggaaacccgccagttacgggaaacacacagagagtgtg
tcgtcgggagttcccttcctgccggcacgcatcgcctggttcctgcaggagttgccttcc
tttgtggtgtcggtagggatgctcgcttggcagccgcgctccctcttcggaccgcccggg
aatgtcctgctggctctcttctctgcacattacttccacaggacatttatttactcgttg
ctcacaagagggaggcctttcccagcggtgctgtttttgagagccactgccttctgcata
gggaacggactccttcaagcctactacctggtttactgcgcagaataccccgaggagtgg
tacacagatgtgcggtttagctttggtgtcttcctgtttattctggggatgggaatcaac
atccacagtgactacaccctgcgccagctcaggaagcctggagaagtcatctataggatt
cctcgaggtggcttgtttacgtatgtctctggagccaatttcctgggcgagattattgaa
tggattggctacgccttggccacgtggtccgtcccagccttcgctttcgcctttttcaca
ctttgtttcctggggatgcaagccttttaccaccacaggttctaccttaagatgtttaag
gattaccccaaatctaggaaagctctcattccattcatcttttaa

DBGET integrated database retrieval system