KEGG   Rattus norvegicus (rat): 64829Help
Entry
64829             CDS       T01003                                 

Gene name
Unc13a, Munc13-1, Unc13h1
Definition
unc-13 homolog A (C. elegans)
Orthology
K15293  
protein unc-13
Organism
rno  Rattus norvegicus (rat)
Pathway
Synaptic vesicle cycle
Class
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:rno04721]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p14
AA seq 1735 aa AA seqDB search
MSLLCVGVKKAKFDGAQEKFNTYVTLKVQNVKSTTIAVRGSQPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDSQAIMADSEICGTKDPTFHR
ILLDAHFELPLDIPEEEARYWAKKLEQLNAMRDQDEYSFQDQQDKPLPVPSSQCCNWNYF
GWGEQNDDPDSAVDDRDSDYRSETSNSIPPPYYTTSQPNASVHQYSVRPPPLGSRESYSD
SMHSYEEFSEPRALSPTGSSRYASSGELSQGSSQLSEDFDPDEHSLQGSELDDERDRDSY
HSCHSSVSYHKDSPRWDQDEEDLEDLEDLEDEELPEEEELEEEELEEEEELEEEELELEE
EEEVPDDLASYTQQEDTTVAEPKEFKRISFPTAAPQKEDKVSAVPIEAPDVSKGIPKAAT
PEEKAAAECAQEAEPPKSEESFRSREAEEGQEGQDAMSRAKANWLRAFNKVRMQLQEARG
EGEMSKSLWFKGGPGGGLIIIDSMPDIRKRKPIPLVSDLAMSLVQSRKAGITSALASSTL
NNEELKNHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTEC
GVKCHEKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEIFELIQE
VFAVTKSAHTQQMKAVKQSVLDGTSKWSAKISITVVCAQGLQAKDKTGSSDPYVTVQVGK
TKKRTKTIYGNLNPVWEENFHFECHNSSDRIKVRVLDEDDDIKSRVKQRFKRESDDFLGQ
TIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLF
HFVTDVQNNGVVKIPDAKGDDAWKVYYDETAQEIVDEFAMRYGVESIYQAMTHFACLSSK
YMCPGVPAVMSTLLANINAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRID
LSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNST
YEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFWSKLITLIVSIIEEDKNSYT
PCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLCKSADYMNLHFKVKWLYNEY
VAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGALERDKKDGFQQTSEHALFSC
SVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNVLLQYADIVSKDFASYCSKE
KEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKELQVKLNNVLDELSHVFATS
FQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVLQPIMDLLDSNLTLFAKICE
KTVLKRVLKELWKLVMNTMERTIVLPPLTDQTMIGTLLRKHGKGLEKGRVKLPSHSDGTQ
MIFNAAKELGQLSKLKDHMVREEAKSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEK
SPDLQSLRYALSLYTQATDLLIKTFVQTQSAQVHGGKGTRFTLSEDVCPEMGSGVEDPVG
EVSVHVELFTHPGTGEQKVTVKVVAANDLKWQTSGIFRPFIEVNIVGPQLSDKKRKFATK
SKNNSWAPKYNESFQFSLSADAGPECYELQVCVKDYCFAREDRTVELAVLQLRELAQRGS
AACWLPLGRRIHMDDTGLTVLRILSQRSNDEVAKEFVKLKSDTRSAEEGGAAPAP
NT seq 5208 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgctgtgcgtgggagtcaaaaaagccaagtttgacggtgcccaagagaagttc
aacacatacgtgacgctgaaggtgcagaacgtgaagagcactaccatagctgtacgcggc
agccagcctagctgggagcaggacttcatgtttgagatcaaccgcctggatctgggcctg
acggtggaggtgtggaacaagggtctcatctgggacacaatggtgggtactgtgtggatc
ccacttcggaccatccgtcagtccaatgaggagggtccgggagaatggctgacactggac
tctcaggccatcatggcggacagtgagatctgtgggaccaaggaccccaccttccaccgc
atcctcctggacgcacattttgagctgcctttggacatccccgaggaggaggcgcgctac
tgggccaagaagctggagcagctgaatgccatgcgtgaccaagatgagtactcctttcag
gaccagcaggacaagccactgccggtgcccagcagccagtgctgcaactggaattacttt
ggctggggagaacagaatgatgatcccgacagtgccgtggatgaccgggacagtgattat
aggagtgagacgagcaacagcatcccaccgccttactacacgacttcgcagcccaatgct
tcggtgcaccagtactccgtgcggccaccccctctggggtcccgggagtcctacagcgac
tccatgcacagctatgaagagttctctgagccgcgggcactcagtcccacaggcagcagc
cgctatgcttccagtggggagctgagccagggcagctcccagctgagtgaggacttcgac
ccggatgagcacagcctacagggctcagagctggatgacgagagggaccgagattcttat
cactcctgccacagctctgtgagctaccacaaggactcaccccgctgggaccaggatgag
gaggacctggaggacctggaggacctggaagatgaggagttgcccgaggaagaggagttg
gaagaggaggagttggaggaggaggaggagttggaggaagaggaattggagttggaggag
gaggaggaggtgcctgatgacctggccagctatacccagcaggaggacaccactgtggct
gagcccaaagagttcaagcggatcagcttcccaacagctgcacctcagaaggaagacaaa
gtttcagctgtgcccattgaggcccccgatgtgtccaaaggcatccccaaggcagccaca
cctgaagagaaggcagctgcggagtgtgcacaggaagcggagccccccaagtctgaggag
agtttcagatctcgagaggctgaggagggccaggaagggcaggatgccatgtccagggcc
aaagccaactggttgcgagccttcaacaaggtgcgcatgcagctgcaggaggcccgagga
gaaggagagatgtccaagtctctgtggttcaaaggcggccctggtggtggccttatcatc
attgacagcatgccagacatcaggaagcggaagcccattcccctcgtgagcgacctggct
atgtctctggtccagtcacggaaggcgggcatcacctcggccttggcctccagcacgttg
aacaatgaagagttgaaaaaccacgtttacaagaagaccctgcaagccttaatctacccc
atctcctgcaccacgccgcacaacttcgaggtgtggacggccaccactcccacctactgc
tacgagtgcgaggggctgctgtggggcatcgcgcggcagggcatgcgctgcaccgagtgc
ggcgttaagtgccacgagaagtgccaagacctgctcaacgcggactgcctgcagcgggcg
gctgagaagagttctaagcatggcgctgaagaccgcacgcagaacatcatcatggtgctg
aaggaccgcatgaagatccgcgagcgcaacaagcctgagatcttcgagctgatccaggag
gtcttcgcggtcaccaagagcgcacacacacagcagatgaaggccgtcaagcagagtgtg
ctggatggcacatccaagtggtctgccaaaattagcatcacggtggtctgtgcccagggc
ttgcaggccaaggacaagacaggatccagtgacccttatgtcaccgtccaggttgggaag
accaagaaaaggacaaaaaccatctacgggaaccttaacccagtgtgggaagagaatttc
cactttgaatgtcacaactcctctgaccggatcaaggtgcgtgtgttggatgaagacgat
gacatcaaatcccgtgtgaagcaaaggtttaagagggagtctgatgacttcctagggcag
acaatcatcgaggtgcggacgcttagcggcgagatggatgtgtggtacaatctggacaag
agaacagacaagtctgctgtgtcgggcgccattcggcttcacatcagtgtggagatcaaa
ggggaggagaaggtggcaccctaccatgtccagtacacctgtctgcatgagaacctgttc
cattttgtgacggatgtacagaacaatggcgtggtgaagattcccgatgccaaaggtgac
gacgcctggaaggtttactatgatgagactgcccaggagatcgtggatgagtttgccatg
cgctatggcgttgaatccatctaccaagccatgacccactttgcctgcctctcctccaag
tacatgtgccctggggtacccgctgtcatgagcaccctgcttgccaacatcaacgcctac
tacgcacacaccaccgcctccaccaacgtgtctgcctccgaccgcttcgctgcctccaat
ttcgggaaagagcgctttgtgaaacttctggaccagctgcacaactccctgcggattgac
ctgtccatgtaccggaacaacttcccggccagcagccccgagcggctgcaggatctcaag
tccacagtggacctgcttaccagcatcaccttcttccggatgaaggttcaggaactgcag
agtccgccacgtgccagtcaggtggtgaaggactgcgtgaaggcgtgcctcaactccacc
tacgagtacatcttcaacaactgtcatgagctctatggccgggagtaccagacagacccg
gccaagaagggggaggtccccccggaggagcaaggccctagcatcaagaacctggatttc
tggtccaagctcatcaccctcatcgtgtctatcattgaggaggataagaactcctacaca
ccctgcctcaatcagtttccccaggagctgaatgtggggaagatcagtgctgaggtgatg
tggagcctgtttgcccaggacatgaagtacgccatggaggaacacgacaagcaccggctg
tgtaagagcgcagactacatgaacctgcatttcaaggtcaagtggttgtacaacgagtac
gtggctgaactgcccaccttcaaggaccgcgtgccggagtaccctgcgtggtttgagccc
ttcgtcatccagtggttagatgagaatgaggaggtgtcccgggacttcctgcatggtgca
ctcgagcgggacaagaaggatgggttccagcagacatcggagcacgccctgttctcttgc
tcggtagtggacgtcttctcccagctcaaccagagctttgagatcatcaagaagctggag
tgtcctgacccccagattgtgggccactacatgcggcgctttgccaagaccattagcaat
gtgcttctccagtacgccgacatcgtctccaaggacttcgcttcctactgctccaaggag
aaggagaaagtgccctgcatcctcatgaacaacacacagcagctgcgggtgcagctggag
aagatgttcgaggcgatgggtgggaaggagctggacgccgaggccagcggaaccctgaag
gagctgcaggtgaaactcaacaatgtcctggatgaactcagccacgtgtttgccaccagc
ttccagccacacatcgaggagtgtgtcagacaaatgggtgacatcctaagccaagtgaag
ggcacgggcaacgtgcccgccagtgcctgcagcagcgtggcacaggacgcagacaacgtg
ctacagcccatcatggatcttctggacagcaacctcaccctgtttgccaaaatctgtgag
aagacggttctgaagcgggtgctgaaggagctgtggaagctggtgatgaacaccatggag
aggaccattgtcctgccgccactcactgaccagacgatgattggtaccctcttgagaaaa
catggcaagggcctagaaaagggcagggtgaaactgccaagccactcagacgggacacaa
atgatcttcaatgccgccaaggagctgggccagctgtccaaactgaaggatcacatggtg
cgagaagaagccaagagcttgaccccgaagcagtgtgccgtggttgaactggccctggac
accatcaagcaatacttccacgcggggggcgtgggcctcaagaagacctttctcgagaaa
agcccggaccttcagtccctgcgctacgccctgtcgctctacacacaggccaccgacctg
ctcatcaaaaccttcgtgcagacgcagtcagcgcaggtccatggtggaaaggggactagg
tttacccttagtgaagacgtttgtcctgagatgggctcgggtgtggaagaccctgtaggt
gaagtatccgtccacgtggagctgttcacgcatccgggaactggggaacagaaggtcaca
gtgaaggtggtggccgccaacgacctcaagtggcagacttctggcatcttccgtccgttc
attgaggtcaacatcgttggacctcagctcagcgacaagaaacgaaagttcgccaccaaa
tcgaaaaacaacagctgggcgcccaaatataacgagagcttccagttctccctgagcgcc
gacgcgggacccgagtgctacgagttgcaggtgtgcgtgaaggactactgcttcgcgcgc
gaggaccgcacggtggagctggcggtgctgcagctgcgggagctggctcagcgcgggagc
gccgcgtgctggctgccgctcggccgccgcatccacatggacgacacggggctcacagtg
ctgcgtatcctgtcgcagcgcagcaatgacgaggtggccaaggagttcgtcaagctcaag
tccgacacgcgctcggccgaggagggcggtgccgcgcctgcgccctag

DBGET integrated database retrieval system