KEGG   Rattus norvegicus (rat): 64830Help
Entry
64830             CDS       T01003                                 

Gene name
Unc13b, Munc13-2, Unc13h2
Definition
unc-13 homolog B (C. elegans)
Orthology
K15293  
protein unc-13
Organism
rno  Rattus norvegicus (rat)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    64830 (Unc13b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q22
AA seq 1622 aa AA seqDB search
MSLLCVRVKRAKFQGSPDKFNTYVTLKVQNVKSTTVAVRGDQPSWEQDFMFEISRLDLGL
SVEVWNKGLIWDTMVGTVWIALKTIRQSDEEGPGEWSTLEAETLMKNDEICGTKNPTPHK
ILLGTRFELPFDIPEEEARYWTYKLEQINALADDNEYSSQEESQRKLLPTAAAQCRHWTY
LGWGEHQTFEDPDSAVDDRDSDYRSETSNSAPPPYHTTTQPNASAHQFPMPVPLPQQLFL
QGSSRDSCNDSMQSYDLDYPERRALSPTSSSRYGSSCNVSRGSSLLSELDQYHEQDDDGR
ERDSIHSSHSYGSLSRDGQAGLGEQEKALEVACESQKEKTGESKERDDATVCPPSDLMLH
KDLTLGPQESFPEEKASSPFTQARAHWFRAVTKVRLQLQEISDDGDPSLPQWLPEGPAGG
LYGIDSMPDLRRKKPLPLVSDLAMSLVQSRKAGITSAMATRTSLKDEDLKSHVYKKTLQA
LIYPISCTTPHNFEVWSATTPTYCYECEGLLWGLARQGMRCSECGVKCHEKCQDLLNADC
LQRAAEKSSKHGAEDRTQNIIMAMKDRMKIRERNKPEIFEVIRDVFTVSKVAHVQQMKTV
KQSVLDGTSKWSAKITITVVCAQGLQAKDKTGSSDPYVTVQVGKTKKRTKTIFGNLNPVW
EEKFHFECHNSSDRIKVRVWDEDDDIKSRVKQRLKRESDDFLGQTIIEVRTLSGEMDVWY
NLEKRTDKSAVSGAIRLQINVEIKGEEKVAPYHVQYTCLHENLFHYLTDIQGSGGVWIPD
ARGDDAWKVYFDETAQEIVDEFAMRYGIESIYQAMTHFACLSSKYMCPGVPAVMSTLLAN
INAYYAHTTASTNVSASDRFAASNFGKERFVKLLDQLHNSLRIDLSTYRNNFPAGSPERL
QDLKSTVDLLTSITFFRMKVQELQSPPRASQVVKDCVKACLNSTYEYIFNNCHDLYSHQY
QLQEQPLEEPGPSIRNLDFWPKLITLIVSIIEEDKNSYTPVLNQFPQELNVGKVSAEVMW
HLFAQDMKYALEEHEKDRLCKSADYMNLHFKVKWLHNEYVRELPALQGQVPEYPAWFEQF
VLQWLDENEDVSLEFLRGGLERDKRDGFQQTSEHALFSCSVVDVFTQLNQSFEIIRKLEC
PDPSILAHYMRRFAKTIGKVLIQYADILSKNFPAYCTKERLPCILMNNMQQLRVQLEKMF
EAMGGKELDSEAADSLKELQVKLNTVLDELSMVFGNSFQVRIDECVRQMADILGQVRGTG
NASPNARASVAQDADSVLRPLMDFLDGNLTLFATVCEKTVLKRVLKELWRVVMNTMERVI
VLPPLIDQTGTQLILTAAKELSQLSKLKDHMVREETRNLTPKQCAVLDLALDTVKQYFHA
GGNGLKKTFLEKSPDLQSLRYALSLYTQTTDTLIKTFVRSQTAQVHDGKGIRFTANEDIR
PEKGAGVDDPVGEVSIQVDLFTHPGTGEHKVTVKVVAANDLKWQTAGMFRPFVEVTMVGP
HQSDKKRKFTTKSKSNSWTPKYNETFHFLLGNEEGPEAYELQICVKDYCFAREDRVIGLA
VMPLRDVAAKGSCACWCPLGRKIHMDETGMTILRILSQRSNDEVAREFVKLKSESRSIEE
GS
NT seq 4869 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgctctgcgtgcgtgttaagagagccaaattccagggttcaccagataagttt
aacacatacgtgaccctgaaagtccagaacgtgaagagcacaactgtagcagttcgtggt
gatcagccttcctgggagcaagatttcatgtttgagatcagccgtctggacctgggccta
agtgtggaggtgtggaacaaagggctgatatgggacacaatggtggggaccgtgtggatc
gcgctgaagactatccgccagtcggatgaggaagggcctggggagtggtctacactggag
gctgagacattaatgaaaaatgatgagatctgtggaactaaaaacccaactcctcataaa
atcttgcttggtacacgatttgagctgccttttgacatcccagaggaggaagccagatat
tggacctacaaattggaacaaataaatgccttggcagatgataatgagtattccagtcaa
gaagaaagccagaggaagctgttgcccactgctgccgcccagtgtcgtcactggacctat
ttgggctggggagagcatcagacctttgaagaccctgatagtgccgttgatgaccgggac
agtgactatcgaagtgagaccagcaatagtgccccacctccttatcacacgactacccag
cccaacgcgtctgcacaccagttccctatgccagtgccactgccacagcagctatttctt
cagggaagttcccgagactcctgcaatgactctatgcagagttatgaccttgattaccca
gagcgtcgggccctcagccccactagcagtagtaggtatggctcctcctgtaatgtgagt
cgaggaagctctctgctgagtgaactggaccagtatcatgagcaagacgatgatggtcgg
gagagggactccattcattctagccatagctatggcagcctctccagagatggccaggct
ggcttgggagaacaagagaaagccttggaagtggcctgtgaatcacagaaggagaaaaca
ggtgaatccaaggagagagatgatgccacagtctgccctccgtcagacctgatgctgcac
aaggacctcaccctaggaccccaggagagttttcccgaggagaaagcatcgtcgcccttt
acccaggccagagcacactggttccgagcggttaccaaggtccgactccagctgcaggag
atttcagatgatggtgacccctccttgcctcagtggctcccagaagggccagcgggaggg
ctctatggcatcgacagcatgccagatctacgaagaaagaagccactgccacttgtcagt
gatctggctatgtcactggtccagtcacggaaagcagggattacttccgctatggctaca
cgtacctctctcaaggatgaagatctgaaatcccatgtgtataagaaaactctgcaggcc
ttaatctaccccatctcgtgcaccacgccccacaactttgaggtctggtctgccacgaca
cccacctactgctatgagtgtgaaggcttgctctggggccttgcccggcaaggcatgcgc
tgcagcgagtgtggcgtcaagtgccatgagaagtgccaagacctgctcaatgccgattgc
ctacagcgggccgctgaaaagagctctaagcacggagctgaggaccggactcagaacatt
atcatggccatgaaggaccgtatgaagatccgagaacggaataaaccagagatctttgag
gttatccgggatgtgttcacagtgagcaaagttgcccacgtgcagcagatgaaaacagta
aagcagagtgtcctggatggcacctccaagtggtcggccaaaattaccatcacggtggtt
tgtgcccagggcctacaagccaaagacaagacaggatccagtgacccttatgtgactgtg
caagttgggaaaaccaagaagcgcactaagaccatttttggaaatttgaatcctgtttgg
gaggagaagttccattttgagtgccacaactcttccgatcgaattaaggtacgtgtgtgg
gatgaggatgatgacatcaaatccagagtaaagcagcggctgaagcgagagtcggatgat
ttccttggccaaactatcattgaagttcgaacgctgagtggagagatggatgtctggtat
aatctggagaagagaacagacaagtcagctgtctcaggggctatccgactgcaaatcaat
gtggagatcaagggggaggagaaggtagccccataccatgtgcaatacacatgtctccat
gagaatcttttccattacctcacagacattcagggcagtggaggagtctggatcccagac
gctcggggggacgatgcatggaaggtgtactttgacgagacagcccaagaaattgtggat
gaatttgccatgcgctatggcatcgagtccatatatcaggccatgacgcactttgcgtgt
ttgtcatccaagtacatgtgtcctggcgtaccagccgtgatgagtaccttactggccaac
atcaatgcgtattatgctcacacaaccgcctccactaacgtctctgcatctgaccgcttt
gccgcctccaactttggtaaagaaagatttgtaaaactgctggaccagctacacaactca
ctgaggatagacctgtctacatacaggaataactttcctgctgggagccctgagcggctc
caggatttaaaatctacagtggacttgctgaccagcattactttcttcaggatgaaggtg
caagaacttcagagccccccaagagccagccaggtggtaaaggactgtgtgaaggcctgc
ttgaactctacatatgaatacatcttcaacaactgccatgacctctacagtcaccaatac
cagctgcaggaacaaccactagaggaaccagggcccagcattcggaacttggatttctgg
cccaaacttatcacactgattgtatcaatcatagaggaggataagaattcctacacacct
gttctgaaccagtttcctcaggagttgaatgtaggaaaagtcagtgcagaagtgatgtgg
cacctgtttgctcaagacatgaaatatgcactggaggaacatgagaaagaccggctgtgt
aagagtgctgactacatgaacctgcacttcaaggtgaagtggctccacaatgaatatgtg
cgggagctgcctgccctccaggggcaggtgcctgagtacccagcgtggtttgagcagttc
gtgctacagtggctagatgaaaatgaagacgtgtccctggaattccttcgtgggggcttg
gaacgagataagagagatgggttccagcaaacatcggagcatgccttgttttcctgttct
gtggtggacgtctttacacaactcaaccagagctttgagatcatccggaaattggaatgt
ccagaccccagcatccttgcccattatatgagaaggtttgctaagaccatcggcaaagtg
ctgatacagtatgcagacatcttatcaaagaacttcccagcttactgcacaaaggagaga
ctgccctgtatcctgatgaacaacatgcagcaactgagggtccagctggagaaaatgttt
gaggccatgggaggcaaagagctggactctgaagctgcagacagtctgaaggagctgcag
gtgaaactgaatacagttctggatgagctcagcatggtgtttggaaacagcttccaggtg
cggatcgacgagtgtgttcgacaaatggctgacatcctgggccaagtacggggcacaggg
aatgcatcccctaacgccagagcctcggtggctcaggatgcagatagtgtgctgcgacct
ctcatggatttcctggatggcaacctcacactgtttgccactgtgtgtgagaagacagtg
ctgaagcgagtcctgaaggagctctggcgagtggtgatgaacaccatggagcgggtcatc
gtcctgcccccactcattgaccagacaggcacccagctgatcttaactgctgccaaggag
ctgagccagctttccaaactcaaggaccacatggtacgagaggaaacacggaatctcact
ccaaagcagtgtgctgtcctcgacttggccttggacaccgtcaagcaatacttccatgca
ggaggcaatggtctgaagaaaaccttcctggaaaagagcccagacctgcagtctctacgt
tatgccctctctctgtatacacagaccacagacactctcatcaagacatttgtgcgctca
cagactgcccaagtacatgatgggaaaggtattaggtttactgctaacgaggacattcgg
ccagaaaagggggctggtgtggacgaccctgtgggagaagtctctattcaggtggacttg
tttacacatcctggcactggggagcataaggtcacagtgaaagtggtagcagccaatgat
ctcaagtggcagacagcaggtatgttccggccttttgtggaagtgaccatggttggccca
caccaaagcgataagaagaggaagttcacaaccaagtctaaaagtaacagctggactccc
aagtacaacgagacttttcatttcctcctgggaaatgaagagggtcccgaggcctatgaa
ttgcagatatgcgtgaaggattactgctttgcccgggaggatcgtgtgataggactggca
gtgatgcccctgagggatgtggcagctaagggcagctgtgcctgctggtgcccgttgggc
cggaagatccacatggatgagacaggcatgaccattctccggattctgtctcagaggagc
aatgatgaggtagcccgagagttcgtgaagctcaagtcagagtctcgatccatagaggaa
gggagctga

DBGET integrated database retrieval system