KEGG   Rattus norvegicus (rat): 65032Help
Entry
65032             CDS       T01003                                 

Gene name
Htr7, 5Ht7
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 7, adenylate cyclase-coupled
  KO
K04163  
5-hydroxytryptamine receptor 7
Organism
rno  Rattus norvegicus (rat)
Pathway
Ras signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    65032 (Htr7)
   04020 Calcium signaling pathway
    65032 (Htr7)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    65032 (Htr7)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    65032 (Htr7)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Serotonin [OT]
    65032 (Htr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q53
AA seq 435 aa AA seqDB search
MMDVNSSGRPDLYGHLRSLILPEVGRGLQDLSPDGGAHPVVSSWMPHLLSGFLEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgccccgacctctacggccatctccgttcactcatc
ctgccggaggtggggcgcgggctgcaggacctgagccccgacggtggcgcccaccctgtg
gtgagctcctggatgccgcacctgctgagtggcttcctagaggtgacggctagcccggcg
cccacctgggacgcgccaccggacaatgtctcaggctgcggggagcagatcaactatggc
agagtggagaaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgca
ggcaactgcctggtggtgatctcggtgtgcttcgtcaagaagctccgccagccctccaac
tacctgattgtgtccctggcgctggctgacctctcggtggccgtggcggtcatgcctttc
gttagtgtcaccgacctcatcgggggcaagtggatcttcggccacttcttctgcaacgtc
ttcatcgccatggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagc
atcgacaggtaccttgggatcacgagacccctcacgtacccggtgaggcaaaatgggaaa
tgtatggccaaaatgattctgtcggtctggctgctctctgcctccatcaccttacctcct
ctcttcggatgggctcagaatgtgaacgatgacaaagtgtgcttgatcagccaggatttt
ggctacacgatctactccactgcggtggcgttttatatccccatgtcggtcatgctgttc
atgtactatcagatttacaaggccgccaggaagagtgcagccaaacacaagttcccaggc
ttcccacgcgtgcagccggagagtgtcatctccctgaatggtgtggtgaagctccagaag
gaggtggaagagtgtgcgaacctttcgagactgctcaaacacgaaaggaaaaacatctcc
atcttcaagcgggaacagaaagcagccactaccttggggatcatcgtgggagccttcact
gtgtgctggctgccgtttttcctcttgtccacagcccgcccctttatctgtggcacctcc
tgtagctgcattcctctgtgggtggagaggacatgtctgtggctgggctatgcaaactct
ctcattaatccttttatatatgccttcttcaaccgggacctgaggaccacctatcgtagc
ctactccagtgccagtaccggaatatcaaccggaagctctctgctgcaggcatgcatgaa
gccctgaaacttgctgagaggcccgagagatccgagtttgtgctgtaa

DBGET integrated database retrieval system