KEGG   Rattus norvegicus (rat): 65130Help
Entry
65130             CDS       T01003                                 

Gene name
Cldn3
Definition
claudin 3
Orthology
K06087  
claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    65130 (Cldn3)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    65130 (Cldn3)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    65130 (Cldn3)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    65130 (Cldn3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   65130 (Cldn3)
  Exosomal proteins of colorectal cancer cells
   65130 (Cldn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12
AA seq 219 aa AA seqDB search
MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA
GVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALL
CCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggcctggagatcaccggcacgtcgctggccgtgctgggctggctgtgcacc
atcgtgtgctgcgcccttcccatgtggcgcgtttcggcattcatcggcagcagcatcatc
acggcgcagatcacctgggaaggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaagatgtacgactcgctgctggccctgccgcaggacctccaggccgcccga
gctctcatcgtggtgtctatcctactggcagccttcgggctcctcgtggcgctcgtgggg
gcccagtgtaccaactgcgtacaagatgagacggccaaggccaagatcaccatcgtggcg
ggagtgcttttcctgttggcggctgtgctcaccttagtgccggtgtcctggtccgccaac
accatcatccgggatttttataacccgctggtacctgaggcccagaagcgagagatggga
actgggttgtacgtgggctgggctgccgccgcgctgcaattgctagggggcgccttgctg
tgttgctcctgcccaccacgcgagaagtacgcacccaccaagatcctctattccgcgccg
cgatccaccggccctggcaccggtaccggcaccgcctatgaccgtaaggactacgtctga

DBGET integrated database retrieval system