KEGG   Rattus norvegicus (rat): 65130Help
Entry
65130             CDS       T01003                                 

Gene name
Cldn3
Definition
claudin 3
Orthology
K06087  
claudin
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Class
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:rno04514]
Cellular Processes; Cell communication; Tight junction [PATH:rno04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:rno04670]
Human Diseases; Infectious diseases; Hepatitis C [PATH:rno05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12
AA seq 219 aa AA seqDB search
MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ
MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA
GVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALL
CCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggcctggagatcaccggcacgtcgctggccgtgctgggctggctgtgcacc
atcgtgtgctgcgcccttcccatgtggcgcgtttcggcattcatcggcagcagcatcatc
acggcgcagatcacctgggaaggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaagatgtacgactcgctgctggccctgccgcaggacctccaggccgcccga
gctctcatcgtggtgtctatcctactggcagccttcgggctcctcgtggcgctcgtgggg
gcccagtgtaccaactgcgtacaagatgagacggccaaggccaagatcaccatcgtggcg
ggagtgcttttcctgttggcggctgtgctcaccttagtgccggtgtcctggtccgccaac
accatcatccgggatttttataacccgctggtacctgaggcccagaagcgagagatggga
actgggttgtacgtgggctgggctgccgccgcgctgcaattgctagggggcgccttgctg
tgttgctcctgcccaccacgcgagaagtacgcacccaccaagatcctctattccgcgccg
cgatccaccggccctggcaccggtaccggcaccgcctatgaccgtaaggactacgtctga

DBGET integrated database retrieval system