KEGG   Rattus norvegicus (rat): 65152Help
Entry
65152             CDS       T01003                                 

Gene name
Pfkm, PFK-A, Pfk-M
Definition
phosphofructokinase, muscle (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    65152 (Pfkm)
   01230 Biosynthesis of amino acids
    65152 (Pfkm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    65152 (Pfkm)
   00030 Pentose phosphate pathway
    65152 (Pfkm)
   00051 Fructose and mannose metabolism
    65152 (Pfkm)
   00052 Galactose metabolism
    65152 (Pfkm)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    65152 (Pfkm)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     65152 (Pfkm)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     65152 (Pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q36
AA seq 780 aa AA seqDB search
MTHEEHHEAKTLGIGKAIAVLTSGGDAQGMNATVRAVVRVGIFTGLRVFFVHEGYQGLVD
GGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKDGKITAEERTKSSYLNIVFLVGSIDNDFCGTDMTIGTDS
ALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNTAVRLPLMECVQVTKDVTK
AMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKNLEQ
ISANITKYNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSI
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGNPTPFDRNFATKMGAKATNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcatcatgaagccaaaaccctggggatcggcaaggccatcgccgtg
ttgacctctggtggagatgcccaaggtatgaatgctacggtcagggctgtggtacgagtt
ggcatcttcaccgggctccgcgtcttctttgtccatgagggttaccaaggcctggtggat
ggtggagagcacatcagggaggccacctgggagagcgtgtccatgatgctccagctggga
ggcacggtgattggaagtgcccgatgcaaggacttccgggagcgagaaggacgactccga
gctgcccacaacctggtgaagcgggggatcaccaatctgtgtgtcatcggaggcgatggc
agcctcactggggctgacacttttcgttcagagtggagtgacttattgaatgacctccag
aaagatgggaagatcacagccgaggagcgtacaaagtccagctacctgaacatcgttttc
ctggttggctcaatcgacaatgacttctgtggcactgatatgaccattggtactgactct
gccctgcaccgcattgtagagatcgtggacgccatcaccaccaccgctcagagccaccag
aggacatttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctct
ctgtcgtgtggggccgactgggttttcattcccgagtgtccgccagatgacgactgggaa
gaacacctttgtcgccgtctcagtgagacaagaacccgtggttctcgtctcaacatcatc
attgttgctgagggtgcaatcgacaaaaacgggaagccaatcacctcagaagacatcaag
aacctggtggtaaagcgtcttggatatgataccagggtcactgttctgggacatgtacag
aggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagacaccccagcctgtgtggtgagcctctctggt
aatacggctgtgcgcctgcccctcatggagtgtgtccaggtgaccaaagacgtgaccaag
gctatggatgagaagagatttgatgaagccattaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcatgtcagacccccagtctctaagggcgggttg
cacacggtggctgtgatgaacgtgggggccccagctgctggaatgaatgctgcagttcgc
tctactgtgaggattggccttatccaaggcaaccgagtgctggtcgtgcatgatggcttt
gagggtctggccaaaggtcagattgaggaagctggctggagctatgttggaggctggact
ggtcaaggtggttccaaacttggtactaaaaggactctacccaagaagaacctggaacag
atcagtgccaacataaccaagtataacatccagggcctggttatcattgggggctttgag
gcttacacagggggcttggagctgatggagggcaggaagcagtttgatgagctctgcatc
ccatttgtggtcattcccgccacggtttccaataatgtcccagggtcagacttcagcatc
ggggctgacacagcactgaacaccatctgcacgacctgtgaccgaatcaagcagtctgca
gcaggcaccaagcggcgagtgtttatcatcgagacgatgggtggttactgtggctatctg
gccaccatggcaggactggcggctggggctgatgctgcctacatttttgaggagcccttc
accatccgagatctccaggttaatgttgaacatctggtgcagaagatgaaaacaactgtg
aagagaggcctggtgctgaggaatgagaagtgcaacgagaactacactactgatttcatt
ttcaacctgtactctgaggaggggaagggcatcttcgacagcaggaagaacgtgcttggc
cacatgcagcagggtggaaacccaactccctttgacaggaattttgccaccaagatgggt
gctaaggctacgaattggatgtctgggaaaatcaaagagagttaccgtaatggacggatc
tttgccaacactcccgactcaggttgtgttctggggatgcgtaagagggccctggtcttt
cagccagtgactgagctgaaggaccagacagattttgagcaccgaatccccaaagaacag
tggtggctgaagctgaggccaatcctcaaaatcctggccaagtacgagattgatctggac
acctctgaccacgcccacctggagcacatttccaggaagcggtctggagaagctgctgtc
tag

DBGET integrated database retrieval system