KEGG   Rattus norvegicus (rat): 65210Help
Entry
65210             CDS       T01003                                 

Gene name
Cyp2j4, CYP2J2
Definition
cytochrome P450, family 2, subfamily j, polypeptide 4
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    65210 (Cyp2j4)
   00591 Linoleic acid metabolism
    65210 (Cyp2j4)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    65210 (Cyp2j4)
  Nervous system
   04726 Serotonergic synapse
    65210 (Cyp2j4)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    65210 (Cyp2j4)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     65210 (Cyp2j4)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   65210 (Cyp2j4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q33
AA seq 501 aa AA seqDB search
MLATAGSLVATIWAALHLRTLLVAALTFLLLADYFKTRRPKNYPPGPWGLPFVGNIFQLD
FGQPHLSIQPFVKKYGNIFSLNLGDITSVVITGLPLIKETFTHIEQNILNRPLSVMQERI
TNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRMQEEAHYLVEAIREEKGKPFNP
HFSINNAVSNIICSVTFGERFEYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYI
PGSHQTVFRNWEKLKLFVSSMIDDHRKDWNPEEPRDFIDAFLKEMSKYPEKTTSFNEENL
ICSTLDLFFAGTETTSTTLRWALLYMALYAEVQEKVQAEIDRVIGQKRAASLADRESMPY
TNAVIHEVQRMGNIIPLNVPREVAMDTTLNGFHLPKGTMVLTNLTALHRDPKEWATPDVF
NPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKFTFKPPTNEKLSL
KFRNGLTLSPVTHRICAVPRE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaccgcgggctctctggtagccacgatctgggcagcgctccatctcaggact
ctgctggtggctgcactcaccttcctactcctggctgactacttcaaaacccggcgcccc
aagaactatcccccggggccttggggtctcccattcgtgggcaacatattccagttggac
tttgggcagccccacctctcaatccagccgtttgtgaagaaatatgggaatatttttagc
ctgaatcttggtgacataacatccgtggtcataactggactgcccttaatcaaagaaacc
tttactcacatagaacaaaacattttgaatcgccctctcagtgttatgcaagaacgcatc
accaataaaaatggattgatcttctccagtggtcagacatggaaggagcaaagaaggttt
gccctgatgacactcaggaattttggcttgggaaagaagagcttagagcagcgcatgcag
gaggaggcccactacctcgtggaagccataagagaggagaaaggaaaacctttcaaccct
cacttcagtatcaacaatgcagtttccaatatcatttgctctgtcacctttggggagcgc
tttgagtaccatgacagtagatttcaggagatgctgaggttgctggatgaggtcatgtat
ttggagacaacaatgataagccagctctataatatttttccatggataatgaagtatatt
cctggatcacatcaaacagttttcagaaactgggaaaaactgaaattgtttgtctcttct
atgatcgatgatcaccggaaagactggaaccctgaggagccaagagacttcattgatgct
ttcctcaaggaaatgtcaaagtacccagagaagactacaagtttcaatgaagaaaacctc
atctgcagcaccctggacctcttctttgcgggaacagagacaacatccactacactgcgc
tgggctctgctctacatggccctctacgcagaagtgcaagaaaaagtacaggcagagatt
gacagagtcattggccagaagagggcagcaagcctggccgatcgagaatccatgccctat
accaatgccgtcatccatgaggtgcagaggatgggcaacatcatccccctgaatgttccc
agggaagtagcaatggataccactttgaatggattccacctgccaaagggtaccatggtt
ctaaccaacctaactgcactgcacagggacccaaaagagtgggccaccccagatgtgttc
aacccagagcactttttggagaatggacagtttaagaagagagaatcttttctgccattc
tcaatgggaaagagagcttgccttggagaacaactggccaggtctgaactgttcattttc
ttcacttctcttatgcaaaaatttaccttcaagcccccaaccaatgagaagctgagcctg
aagttcagaaatggcctcacactttctccagtcacgcaccgcatctgtgctgtccctaga
gaatga

DBGET integrated database retrieval system