KEGG   Rattus norvegicus (rat): 65210Help
Entry
65210             CDS       T01003                                 

Gene name
Cyp2j4, CYP2J2
Definition
cytochrome P450, family 2, subfamily j, polypeptide 4
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:rno04913]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:rno04726]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:rno04750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q33
AA seq 501 aa AA seqDB search
MLATAGSLVATIWAALHLRTLLVAALTFLLLADYFKTRRPKNYPPGPWGLPFVGNIFQLD
FGQPHLSIQPFVKKYGNIFSLNLGDITSVVITGLPLIKETFTHIEQNILNRPLSVMQERI
TNKNGLIFSSGQTWKEQRRFALMTLRNFGLGKKSLEQRMQEEAHYLVEAIREEKGKPFNP
HFSINNAVSNIICSVTFGERFEYHDSRFQEMLRLLDEVMYLETTMISQLYNIFPWIMKYI
PGSHQTVFRNWEKLKLFVSSMIDDHRKDWNPEEPRDFIDAFLKEMSKYPEKTTSFNEENL
ICSTLDLFFAGTETTSTTLRWALLYMALYAEVQEKVQAEIDRVIGQKRAASLADRESMPY
TNAVIHEVQRMGNIIPLNVPREVAMDTTLNGFHLPKGTMVLTNLTALHRDPKEWATPDVF
NPEHFLENGQFKKRESFLPFSMGKRACLGEQLARSELFIFFTSLMQKFTFKPPTNEKLSL
KFRNGLTLSPVTHRICAVPRE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccaccgcgggctctctggtagccacgatctgggcagcgctccatctcaggact
ctgctggtggctgcactcaccttcctactcctggctgactacttcaaaacccggcgcccc
aagaactatcccccggggccttggggtctcccattcgtgggcaacatattccagttggac
tttgggcagccccacctctcaatccagccgtttgtgaagaaatatgggaatatttttagc
ctgaatcttggtgacataacatccgtggtcataactggactgcccttaatcaaagaaacc
tttactcacatagaacaaaacattttgaatcgccctctcagtgttatgcaagaacgcatc
accaataaaaatggattgatcttctccagtggtcagacatggaaggagcaaagaaggttt
gccctgatgacactcaggaattttggcttgggaaagaagagcttagagcagcgcatgcag
gaggaggcccactacctcgtggaagccataagagaggagaaaggaaaacctttcaaccct
cacttcagtatcaacaatgcagtttccaatatcatttgctctgtcacctttggggagcgc
tttgagtaccatgacagtagatttcaggagatgctgaggttgctggatgaggtcatgtat
ttggagacaacaatgataagccagctctataatatttttccatggataatgaagtatatt
cctggatcacatcaaacagttttcagaaactgggaaaaactgaaattgtttgtctcttct
atgatcgatgatcaccggaaagactggaaccctgaggagccaagagacttcattgatgct
ttcctcaaggaaatgtcaaagtacccagagaagactacaagtttcaatgaagaaaacctc
atctgcagcaccctggacctcttctttgcgggaacagagacaacatccactacactgcgc
tgggctctgctctacatggccctctacgcagaagtgcaagaaaaagtacaggcagagatt
gacagagtcattggccagaagagggcagcaagcctggccgatcgagaatccatgccctat
accaatgccgtcatccatgaggtgcagaggatgggcaacatcatccccctgaatgttccc
agggaagtagcaatggataccactttgaatggattccacctgccaaagggtaccatggtt
ctaaccaacctaactgcactgcacagggacccaaaagagtgggccaccccagatgtgttc
aacccagagcactttttggagaatggacagtttaagaagagagaatcttttctgccattc
tcaatgggaaagagagcttgccttggagaacaactggccaggtctgaactgttcattttc
ttcacttctcttatgcaaaaatttaccttcaagcccccaaccaatgagaagctgagcctg
aagttcagaaatggcctcacactttctccagtcacgcaccgcatctgtgctgtccctaga
gaatga

DBGET integrated database retrieval system