KEGG   Rattus norvegicus (rat): 65248Help
Entry
65248             CDS       T01003                                 

Gene name
Prkaa1, AMPKalpha1
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04371  Apelin signaling pathway
rno04530  Tight junction
rno04710  Circadian rhythm
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno04920  Adipocytokine signaling pathway
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05410  Hypertrophic cardiomyopathy (HCM)
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    65248 (Prkaa1)
   04068 FoxO signaling pathway
    65248 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    65248 (Prkaa1)
   04152 AMPK signaling pathway
    65248 (Prkaa1)
   04150 mTOR signaling pathway
    65248 (Prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    65248 (Prkaa1)
  Cellular community - eukaryotes
   04530 Tight junction
    65248 (Prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    65248 (Prkaa1)
   04922 Glucagon signaling pathway
    65248 (Prkaa1)
   04920 Adipocytokine signaling pathway
    65248 (Prkaa1)
   04921 Oxytocin signaling pathway
    65248 (Prkaa1)
  Aging
   04211 Longevity regulating pathway - mammal
    65248 (Prkaa1)
   04213 Longevity regulating pathway - multiple species
    65248 (Prkaa1)
  Environmental adaptation
   04710 Circadian rhythm
    65248 (Prkaa1)
   04714 Thermogenesis
    65248 (Prkaa1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    65248 (Prkaa1)
   05410 Hypertrophic cardiomyopathy (HCM)
    65248 (Prkaa1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    65248 (Prkaa1)
   04931 Insulin resistance
    65248 (Prkaa1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     65248 (Prkaa1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   65248 (Prkaa1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    65248 (Prkaa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    65248 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    65248 (Prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 65248
NCBI-ProteinID: NP_062015
RGD: 3387
Ensembl: ENSRNOG00000012799
UniProt: P54645
Structure
PDB: 

Jmol
Position
2q16
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSEVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggcgtcggcaccttcgggaaa
gtgaaggtgggcaagcacgagttgactggacataaagttgctgtgaagatactcaaccgg
cagaagattcgaagcctggacgtggtcgggaaaatccgcagagagatccagaacctgaag
cttttcaggcaccctcatataatcaaactgtaccaggtcatcagtacaccgtctgatatt
ttcatggtcatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggttggacgaaaaggagagtcgacgtctgttccagcagatcctttctggtgtggactat
tgtcacaggcatatggtggtccacagagatttgaaacctgaaaacgtcctgcttgatgca
cacatgaatgcaaagatagccgacttcggtctttcaaacatgatgtcagatggtgaattt
ttaagaacgagctgtggctcgcccaattatgctgcaccagaagtaatttcaggaagattg
tacgcaggccctgaagtagacatctggagcagcggggtcattctctatgctttgctgtgt
ggaactctcccttttgatgatgaccacgtgccaactctttttaagaagatatgtgacggg
atattttatacccctcagtatttgaatccctctgtaataagccttttgaagcatatgctg
caggtagatcctatgaagagggccacaataaaagatatcagggaacatgaatggtttaag
caggaccttccaaaatatctctttcctgaagacccgtcttatagttcaaccatgattgat
gatgaagccttaaaagaagtgtgtgagaagttcgagtgctcagaggaggaggtcctcagc
tgcctgtacaacagaaaccaccaggacccactggcagttgcctaccacctcataatagac
aacaggagaataatgaacgaagccaaagatttctacttggcaacaagcccacccgattct
ttcctcgatgatcaccatttaactcggcctcaccctgagagagtaccattcttggttgcc
gaaacaccaagggcccgacacaccctagatgaattaaacccacagaaatccaaacaccaa
ggcgtacggaaggcaaagtggcatttggggattcgaagtcaaagccgacccaatgacatc
atggcagaagtgtgtagagcaatcaagcagttggactatgaatggaaggttgtaaacccc
tattatttgcgtgtgcgaaggaagaaccctgtgacaagcacattttccaaaatgagtcta
cagctataccaagtggatagtaggacttacttattggatttccgaagtattgatgatgag
attacagaagccaaatcagggactgctactccacagagatcgggatccatcagcaactat
cgatcttgccaaaggagcgactccgacgccgaggctcaaggaaagccctcagaagtctct
cttacctcatccgtgacctccctcgactcctctcctgttgacgtagctccaagaccagga
agtcacacgatagaattttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system