KEGG   Rattus norvegicus (rat): 65248Help
Entry
65248             CDS       T01003                                 

Gene name
Prkaa1, AMPKalpha1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit (EC:2.7.11.1 2.7.11.26 2.7.11.27 2.7.11.31)
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    65248 (Prkaa1)
   04151 PI3K-Akt signaling pathway
    65248 (Prkaa1)
   04152 AMPK signaling pathway
    65248 (Prkaa1)
   04150 mTOR signaling pathway
    65248 (Prkaa1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    65248 (Prkaa1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    65248 (Prkaa1)
   04920 Adipocytokine signaling pathway
    65248 (Prkaa1)
   04921 Oxytocin signaling pathway
    65248 (Prkaa1)
  Environmental adaptation
   04710 Circadian rhythm
    65248 (Prkaa1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    65248 (Prkaa1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    65248 (Prkaa1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     65248 (Prkaa1)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   65248 (Prkaa1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    65248 (Prkaa1)
  Mitophagy factors
   Other mitophagy factors
    65248 (Prkaa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q16
AA seq 559 aa AA seqDB search
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTFSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSISNYRSCQRSDSDAEAQGKPSEVSLTSSVTSLDSSPVDVAPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacggccgagaagcagaagcacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggcgtcggcaccttcgggaaa
gtgaaggtgggcaagcacgagttgactggacataaagttgctgtgaagatactcaaccgg
cagaagattcgaagcctggacgtggtcgggaaaatccgcagagagatccagaacctgaag
cttttcaggcaccctcatataatcaaactgtaccaggtcatcagtacaccgtctgatatt
ttcatggtcatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggttggacgaaaaggagagtcgacgtctgttccagcagatcctttctggtgtggactat
tgtcacaggcatatggtggtccacagagatttgaaacctgaaaacgtcctgcttgatgca
cacatgaatgcaaagatagccgacttcggtctttcaaacatgatgtcagatggtgaattt
ttaagaacgagctgtggctcgcccaattatgctgcaccagaagtaatttcaggaagattg
tacgcaggccctgaagtagacatctggagcagcggggtcattctctatgctttgctgtgt
ggaactctcccttttgatgatgaccacgtgccaactctttttaagaagatatgtgacggg
atattttatacccctcagtatttgaatccctctgtaataagccttttgaagcatatgctg
caggtagatcctatgaagagggccacaataaaagatatcagggaacatgaatggtttaag
caggaccttccaaaatatctctttcctgaagacccgtcttatagttcaaccatgattgat
gatgaagccttaaaagaagtgtgtgagaagttcgagtgctcagaggaggaggtcctcagc
tgcctgtacaacagaaaccaccaggacccactggcagttgcctaccacctcataatagac
aacaggagaataatgaacgaagccaaagatttctacttggcaacaagcccacccgattct
ttcctcgatgatcaccatttaactcggcctcaccctgagagagtaccattcttggttgcc
gaaacaccaagggcccgacacaccctagatgaattaaacccacagaaatccaaacaccaa
ggcgtacggaaggcaaagtggcatttggggattcgaagtcaaagccgacccaatgacatc
atggcagaagtgtgtagagcaatcaagcagttggactatgaatggaaggttgtaaacccc
tattatttgcgtgtgcgaaggaagaaccctgtgacaagcacattttccaaaatgagtcta
cagctataccaagtggatagtaggacttacttattggatttccgaagtattgatgatgag
attacagaagccaaatcagggactgctactccacagagatcgggatccatcagcaactat
cgatcttgccaaaggagcgactccgacgccgaggctcaaggaaagccctcagaagtctct
cttacctcatccgtgacctccctcgactcctctcctgttgacgtagctccaagaccagga
agtcacacgatagaattttttgaaatgtgtgcaaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system