KEGG   Rattus norvegicus (rat): 65270Help
Entry
65270             CDS       T01003                                 

Gene name
Gbgt1, Abo, Abol1
Definition
globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 (EC:2.4.1.37 2.4.1.40)
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    65270 (Gbgt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     65270 (Gbgt1)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     65270 (Gbgt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  ABO blood group
   65270 (Gbgt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p13
AA seq 348 aa AA seqDB search
MDLRGRPKCYSLHLGILPFIVLVLVFFGYGFLSHKIQEFRNPGGETCMATRQTDVQKVVS
VPRMAYPQPNVLTPIRNDVLVFTPWLAPIIWEGTFNIDILNEQFKLQNTTIGLTVFAIKK
YVVFLKLFLETAEQHFMVGHKVIYYVFTDRPSDVPQVPLGAGRKLVVLTVRNYTRWQDVS
MHRMEMISHFSEQRFQHEVDYLVCGDVDMKFSDHVGVEILSALFGTLHPGFYRSRRESFT
YERRPKSQAYIPRDEGDFYYAGGFFGGSVVEVHHLTKACHQAMVEDQANGIEAVWHDESH
LNKYLLYHKPTKVLSPEYVWDQKLLGWPSIMKKLRYVAVPKNHQAIRN
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggacctcagaggaagaccgaaatgctactcacttcaccttggaatccttcccttcatt
gtgcttgtcttagtcttctttggctatggattcctgagccacaaaatccaggaattcagg
aacccaggaggtgagacttgcatggctaccaggcagacggatgtccagaaagttgtaagt
gtgccaaggatggcctatccacagccaaacgtgctaacacccattaggaatgatgttctt
gtcttcactccttggctggctcccatcatctgggaggggaccttcaacatcgacatactg
aatgagcagttcaagcttcagaataccacaattggactgactgtgtttgccatcaaaaag
tatgtggtgttcctgaaactcttcctggagacggcagagcagcacttcatggtgggacac
aaggtcatctattatgtattcactgaccggccatctgatgtgccacaggtgcccctgggc
gcagggcggaagctggtggtgctaactgtgcgcaactacacccgctggcaggacgtgtcc
atgcacaggatggagatgatcagccacttctcagagcagcgctttcagcatgaggtggac
tatctggtgtgtggagatgtggacatgaagttcagtgaccacgtgggtgtggagattctc
tcagcgctctttggcaccctgcatcctggcttctaccgtagccgacgagagtcctttacc
tatgagcgccggccaaagtctcaggcctacatccccagggatgagggtgacttttactat
gcagggggtttctttgggggatcagtggtggaggtgcaccatctcaccaaggcctgccac
caggctatggtagaggaccaggccaatggtattgaggctgtgtggcatgacgagagccat
ttgaacaagtacctgctataccataagcctacaaaggtgctgtccccagagtatgtgtgg
gaccagaagctgctgggctggccctccatcatgaagaagctgagatatgtggccgtgccc
aagaaccatcaggcgatcaggaactga

DBGET integrated database retrieval system