KEGG   Rattus norvegicus (rat): 66026Help
Entry
66026             CDS       T01003                                 

Gene name
Trpv4, Otrpc4, Vroac
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 4
  KO
K04973  
transient receptor potential cation channel subfamily V member 4
Organism
rno  Rattus norvegicus (rat)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    66026 (Trpv4)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   66026 (Trpv4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q16
AA seq 871 aa AA seqDB search
MADPGDGPRAAPGDVAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPVDASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVVEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSYLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
ALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS
NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLLTGVLFFFTSIKDLFMKKCPGV
NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCNEDQSNCTVPSYPAC
RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTMGRLRRDRWSSVVPRVVELNKNSGTDE
VVVPLDNLGNPNCDGHQQGYAPKWRAEDAPL
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcctggtgatggcccccgtgcagcgcctggggatgtggctgagccccctgga
gacgagagtggcacttctggtggggaggccttccccctctcttccctggccaacctgttt
gagggagaggaaggctcctcttctctttcaccagtggatgctagccgccctgctggcccc
ggggatggacgtccaaacctgcgtatgaagttccagggcgctttccgcaagggggttccc
aaccccattgacctgctggagtccaccctgtatgagtcctcagtagtgcctgggcccaag
aaagcgcccatggattcgttgttcgactatggcacttaccggcaccaccccagtgacaac
aagagatggaggaggaaggtcgtagagaagcagccacagagccccaaagctcccgccccc
cagccaccccccatcctcaaagtcttcaaccggcccatcctctttgacatcgtgtcccgg
ggctccactgccgacctggacggactgctctcctacttgctgacccacaagaagcgcctg
actgatgaggagttccgggaaccatccacagggaagacctgcctgcccaaggcacttctg
aacttaagcaatggccgaaacgacaccatcccagtgttgctggacattgcggaacgcacg
ggcaacatgcgggagttcatcaactcgcccttcagagacatctactaccgagggcagacg
gcactgcacatcgccattgaacggcgctgcaagcattacgtggagctcctggtggcccag
ggagccgatgtgcacgcgcaggcccgagggcggttcttccagcccaaggatgagggtggc
tacttctactttggggagctgcccttgtccttggcagcctgcaccaaccagccgcacatc
gtcaactacctgacagagaaccctcacaagaaagccgatatgaggcgacaggactccaga
ggcaacacggtgctccacgcgctggtggccatcgctgacaacacccgagagaacaccaag
tttgtcaccaagatgtatgacctgttgcttctcaagtgctcccgcctcttcccagacagc
aacctggagactgtgcttaacaatgacggtctttcgcccctcatgatggctgccaagact
ggcaagatcggggtctttcagcacatcatccgacgggaggtgacagatgaggacacacgg
cacctgtctcgcaagttcaaggactgggcctacgggcctgtgtattcttctctctacgac
ctctcctccctggatacgtgcggggaggaagtgtccgtgctggagatcctggtttacaac
agcaagatcgagaaccgccatgagatgctggctgtggagcccattaacgaactgctgagg
gacaagtggcgtaagttcggggccgtgtccttctacatcaacgttgtctcctatctgtgt
gccatggtcatcttcaccctcacagcctactatcagccactggagggcacgccaccctac
ccttaccgtaccacggtggactacctgaggctggctggtgaggtcatcacgctcctcaca
ggagtcctgttcttctttaccagtatcaaagacttgttcatgaagaaatgccctggagtg
aattctctcttcgtcgatggctccttccagttgctctacttcatctactcagtgctggtg
gttgtgtctgcggcgctctacctggcagggatcgaggcctatctggctgtgatggtcttt
gccctggtcctgggctggatgaatgccctttacttcacccgtgggctgaagctgacaggg
acctacagcatcatgattcagaagatcctcttcaaagatctcttccgctttctgctggtc
tacctgctttttatgattggctatgcctcagctctggtcaccctcctgaatccgtgcacc
aacatgaaggtctgtaacgaggaccagagcaactgcacggtgccctcataccccgcgtgc
cgggacagcgagaccttcagcgccttcctactggacctcttcaagctcaccatcggcatg
ggcgacctggagatgctgagcagcgctaagtaccccgtggtcttcattctcctgctggtt
acctacatcatcctcaccttcgtgctcctgctgaacatgctcatcgccctcatgggtgag
accgtgggccaggtgtccaaggagagcaagcacatctggaagctgcagtgggccaccacc
atcctggacatcgagcgctccttccctgtgttcctgaggaaggccttccgctccggagag
atggtgacagtgggcaagagctcggatggcactccagaccgcaggtggtgcttcagggtg
gacgaggtgaactggtctcactggaaccagaacctgggcatcattaacgaggaccccggc
aagagcgagatctaccagtactatggcttctcccataccatggggcgcctccgcagggat
cgctggtcctcagtggtgccccgcgtggtggagctgaacaagaactcaggcacagatgaa
gtggtggtccccctggataacctagggaaccccaactgtgacggccaccagcaaggttat
gctcccaagtggagggcggaggacgcaccactgtag

DBGET integrated database retrieval system