KEGG   Rattus norvegicus (rat): 679149Help
Entry
679149            CDS       T01003                                 

Definition
similar to carboxylesterase 2 (intestine, liver) (EC:3.1.1.1)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    679149
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     679149
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     679149
    3.1.1.84  cocaine esterase
     679149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
19
AA seq 561 aa AA seqDB search
MPQNQLHSWLNAVFFGLLLLLIHVQGQHSPESSPIRNTHIGQVRGKLDHVKDTKAGVHTF
LGIPFAKPPVGPLRFAPPEAPEPWSGVRDGTSQPAMCLQNLDVINAEGLKEMKLKLPPVS
MSEDCLYLNIYAPAHAHEGSNLPVMVWIHGGGLMTGMASMYDGSLLTVNEDLVVVTIQYR
LGVLGFFSTGDEHARGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTCVSTHV
VSPMSQGLFHGAIMESGVALLPYLIADTSEMFSTMVAKVSGCEAMDSEALVHCLRAKSEA
EILAINKVVQMVPAVVDGEFLPRHPKELLASEDFRPVPSIIGVNNDEYGWTIPLVMGTTQ
MIKELSRENLQAILKKTTAQLMLPLECSDLLMEEYMGDIEDPKTLQAQFTELMEDFMFVI
PALQVAHFQCSHAPVYFYEFQHQITFLKDIRPPHVKADHGDEIPFVFGYFFWDMKTDFTE
EEKLLSRRMMKYWANFARHGNPNSEGLSYWPVMDHDQQYLQLDTQPAVGRALKARRLQFW
TKTLPQKIQELKGAQDNHTEL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgccacagaaccaactccatagctggctgaatgctgtgttctttgggctgctgcttctt
cttatccatgtgcagggtcagcactcaccagagtccagccccatcagaaacacacacata
ggccaggtccgaggcaagcttgaccacgtgaaggacactaaagctggtgtccacaccttc
ctgggaattccctttgccaagcctcctgtaggaccactgcgctttgcacctcctgaggcc
cctgagccatggagtggtgtgagagatgggacctcacaaccagccatgtgtctgcaaaat
cttgatgtaatcaatgcagaggggttgaaggagatgaaactgaagctgcctcctgtctct
atgtctgaggactgcctgtacctcaacatctatgcaccagcccatgcccatgagggctct
aacctgcctgtaatggtgtggatccatggtggaggactgatgacaggcatggcttccatg
tatgatggatctctattgacagtcaatgaggacttggtggttgtcactatccagtatcgt
ctgggtgtcctaggctttttcagcactggagatgagcacgccagaggcaactggggatac
ctggaccaagtggctgccctaagatgggtccagcagaatatcgcccactttggaggcaac
cctgatcgtgtcactatttttggcgagtctgcaggtggtacatgtgtgtctacacatgtt
gtgtcccccatgtcccaaggactctttcatggagccatcatggaaagtggagtggccctg
ctgccctaccttattgctgacacctctgagatgttctctactatggtagccaaggtctct
ggatgtgaggccatggactcagaggccctggtgcactgtctaagagccaagagtgaagca
gagattctggctattaacaaggttgtgcagatggtccctgctgtggtggatggagagttc
ctacccaggcatcccaaagagttgttggcatctgaggattttcgccctgtccccagcatc
attggtgtcaacaatgatgaatacggttggaccattcctctggtcatgggcactactcaa
atgataaaggagctatccagagagaacctgcaagctattcttaagaagacaacagcacaa
ctgatgctgcctctggagtgcagtgacctattgatggaagagtacatgggggacattgag
gaccctaagaccctccaagcacagtttacagagttgatggaagacttcatgtttgtgatc
cctgcactgcaagtggcacattttcagtgttcccatgcccctgtctacttttatgagttc
caacatcagatcaccttcctcaaggatatcaggccaccccacgtgaaggctgaccatggt
gatgaaattccttttgtctttgggtacttcttttgggacatgaaaactgacttcactgag
gaggagaagctgctgagcaggaggatgatgaagtactgggccaactttgcaagacatggg
aaccccaacagtgagggtctatcctactggcccgtgatggaccatgatcagcagtacctg
cagctggacacccagcctgctgtgggcagagccctgaaggccagaaggctgcagttctgg
acaaagactctgccccagaagatccaggagctaaagggggctcaggacaatcacacagag
ctttag

DBGET integrated database retrieval system