KEGG   Rattus norvegicus (rat): 679368Help
Entry
679368            CDS       T01003                                 

Definition
similar to carboxylesterase 5
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:rno00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
19
AA seq 559 aa AA seqDB search
MTLYKRPGCLNAVTCGLLLLVLHVRGQDSASPIRNTHTGQVRGSLVHVKDTDIDVHTFLG
IPFAKPPVGPLRFAPPEAPEPWSGVRDATSHPAMCLQNDNMMGSEDMKIMKLILPPISMS
EDCLYLNIYAPTHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVTIQYRLG
VLGFFSTGDEHARGNWGYLDQVAALRWVQQNIAHFGGNPNRVTIFGESAGGTSVSSHVVS
PMSQGLFHGAIMESGVVVLPDLISRSSEMVYRIVANLSGCAAVDSETLMQCLRGKSEAEI
LDINKVFKIIPAVVDGEFLPKHPQELLASANFHRVPSIIGINNDEYGWILPMIFDSAQKI
EEITRKTLPTVLKSTALKMMLPPECGDLLMEEYMGDTEDPKTLQAQFREMMGDFMFVIPA
LQVAHFQRSHAPVYFYEFQHRSSFFKDVKPPHVKADHGDEVFLVFGYLVGDIKFPHTEEE
ELLSRKIMKYWANFARHGNPNSEGLPHWPVMDHDDQYLQLDIQPSVGRALKARRLKFWTK
TLPQKIQELKGAQERHREL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgacactgtacaaacgtcctggatgtctgaatgctgtgacttgtgggctcctgcttctc
gtcctgcatgtgagaggccaggactcggccagccccatcaggaacacacacacaggccag
gtaagaggcagcctcgtccatgtgaaagacactgacattgatgtccacaccttcctggga
attccctttgccaagcctcctgtaggaccgctgcgctttgcacctcctgaggcccctgag
ccatggagtggtgtgagagatgcgacctcacatccggccatgtgtctacaaaatgacaat
atgatgggttcagaggatatgaagataatgaaattgatcctgccccccatctctatgtct
gaggactgcctgtatctcaacatctatgcaccaacccatgcccatgagggttctaatttg
cctgtgatggtgtggatccatggtggtgcactcactgtaggcatggcttccatgtatgat
ggctccatgctggcagcgactgaggatgtggtggtggtcactatccagtatcgtctgggt
gtcctgggattcttcagcactggagatgagcatgcaagaggcaactggggatacctggac
caagtggctgcccttcgctgggtccagcagaacatcgcccactttggaggcaaccccaac
cgtgtcactatttttggcgagtcagcaggtggcacaagtgtatcctcacatgttgtatcc
cccatgtcacaggggctcttccatggtgccatcatggagagtggagtagttgtgcttcct
gatcttatctcccgttcctctgagatggtttacagaatagtggccaatctatctggttgt
gcagctgtggactcagagaccctgatgcagtgcctaagaggcaagagtgaagcagagatt
ctggatattaataaggtcttcaagatcatccctgctgtggtggatggagagttcctaccc
aagcatcctcaggagctgctggcctctgctaattttcaccgtgtccccagcatcattggc
atcaacaatgatgagtatggttggattctccctatgatctttgactcagctcagaaaata
gaggaaataaccagaaagaccctgccaactgttctaaagagcacagccctaaaaatgatg
ctgcctcctgagtgtggtgacctgctaatggaagagtacatgggggacactgaggacccc
aagactctccaagcacagttcagagagatgatgggagacttcatgttcgtgatccctgca
ctccaagtagcacattttcagcgttcccatgctcctgtctacttctatgagttccaacat
cggtccagcttcttcaaggatgtcaagccaccccatgtgaaggctgaccatggtgatgaa
gttttccttgtctttggctacctagttggtgacataaaatttccacacactgaggaggag
gagctacttagcagaaagataatgaagtactgggccaactttgcacggcatgggaacccc
aacagtgagggtctaccccactggcctgtgatggaccatgatgatcaatacctgcagctg
gacatccagccttctgtaggtcgagccctgaaggccagaaggctgaagttctggaccaag
actctgccccagaagatccaggagctaaagggggctcaggagaggcacagagagttgtag

DBGET integrated database retrieval system