KEGG   Rattus norvegicus (rat): 679794Help
Entry
679794            CDS       T01003                                 

Definition
similar to Cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
rno  Rattus norvegicus (rat)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rno00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:rno04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:rno04115]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Colorectal cancer [PATH:rno05210]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:rno05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:rno05012]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:rno05014]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:rno05416]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:rno04932]
Human Diseases; Infectious diseases; Legionellosis [PATH:rno05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:rno05152]
Human Diseases; Infectious diseases; Influenza A [PATH:rno05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:rno05161]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:rno05168]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:rno05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1p11
AA seq 105 aa AA seqDB search
MCDVEKGKKIFVQECAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKSKGIAW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKATDE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatgttgaaaaaggcaagaagatttttgttcaggagtgtgcccagtgccacact
gtggaaaaaggaggcaagcataagactggaccaaacctccatggtctgtttgggcgaaag
acaggccaggctgctggattctcttacacagatgccaacaagagcaaaggcattgcctgg
ggagaggataccctgatggagtatttggaaaatcccaaaaagtacatccctggaacaaaa
atgatctttgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aaggctactgatgagtaa

DBGET integrated database retrieval system