KEGG   Rattus norvegicus (rat): 680312Help
Entry
680312            CDS       T01003                                 

Gene name
Hist1h2bk, Hist1h2bc
Definition
histone cluster 1, H2bk
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    680312 (Hist1h2bk)
  Immune diseases
   05322 Systemic lupus erythematosus
    680312 (Hist1h2bk)
  Substance dependence
   05034 Alcoholism
    680312 (Hist1h2bk)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680312 (Hist1h2bk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17q11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacctgccaagtccgcccccgcaccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatctttgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgttgcttcctggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aaatacaccagcgctaagtaa

DBGET integrated database retrieval system