KEGG   Rattus norvegicus (rat): 680403Help
Entry
680403            CDS       T01003                                 

Gene name
Hist1h2bcl1, Hist1h2bc
Definition
histone cluster 1, H2bc-like 1
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    680403 (Hist1h2bcl1)
  Immune diseases
   05322 Systemic lupus erythematosus
    680403 (Hist1h2bcl1)
  Substance dependence
   05034 Alcoholism
    680403 (Hist1h2bcl1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   680403 (Hist1h2bcl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
17q11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaaaaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgcttcccggggagttggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaagtga

DBGET integrated database retrieval system