KEGG   Rattus norvegicus (rat): 680403Help
Entry
680403            CDS       T01003                                 

Gene name
Hist1h2bcl1, Hist1h2bc
Definition
histone cluster 1, H2bc-like 1
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:rno05322]
Human Diseases; Substance dependence; Alcoholism [PATH:rno05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
17q11
AA seq 134 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSNSSRQSFSV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaagtccgctcccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaaaaagcgcaagcgcagccgcaaggagagctactcggtg
tacgtgtacaaggtgctgaagcaagtacacccggacacgggcatctcttccaaggccatg
ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgcttcccggggagttggccaagcacgcggtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaattcttcaagacaaagtttctctgtgtag

DBGET integrated database retrieval system