KEGG   Rattus norvegicus (rat): 681309Help
Entry
681309            CDS       T01003                                 

Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    681309
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    681309
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    681309
  Cell communication
   04510 Focal adhesion
    681309
 Human Diseases
  Infectious diseases
   05144 Malaria
    681309
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   681309
  Exosomal proteins of colorectal cancer cells
   681309
  Exosomal proteins of bladder cancer cells
   681309
Heparan sulfate/heparin binding proteins [BR:rno00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  681309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
2q34
AA seq 955 aa AA seqDB search
MEKPELWVALALLLCSYTCGSQDLQVIDLLTVSESRQMAAVAEKVRTALLTAGDIYLLST
FRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGR
THTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRMQ
GFVESMKIILGGSMARVGALSECPFQGDESIHNAVTSALQSILGEQTKALVTQLTLFNQI
LVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGLRCG
PCPPGLRGNGTHCEDIDECAHADPCFLGSSCINTMPGFHCEACPQGYKGTRVSGVGIDYA
RASKQVCSDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCTPARTCHSP
AHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQD
NCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDN
CPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDTCDSC
PEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDS
DDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAEV
TLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTF
HVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSISGP
GEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWRLLHRPQVGYIRVKLYEGPQLV
ADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccggaactttgggttgccctggctctcctcctttgctcttacacatgtggc
agtcaggaccttcaggtaattgacctgctgacggtgagtgagtccaggcagatggcagct
gtagcagagaaggtccggacagctttactcactgctggggacatctacctcttgtccact
ttccgcctccctccaaagcaaggtggtgtcctctttggcctctactctcgccaagacaac
acacgatggctggaggcctctgttgttggcaagatcaacaaagtgctggtgcggtaccag
cgggaagatggcaaagtgcacgcagtgaaccttcagcaagcaggcttggctgacgggcgc
acgcacaccgctctcctgcgactccgaggaccttctcgacccagccctggcctgcaactg
tatgtggactgtaaactgggtgaccaacacgctggcctcccagccctagcgcccattcct
ccagcggaggtcagcggactggagattagaacaggacaaaaggcttacctgaggatgcag
ggctttgtggaatcgatgaagattattttgggtggatcgatggctcgggtgggagccctg
agcgaatgtccgttccaaggagatgaatccattcacaatgcagtgaccagcgcgctgcag
tccattctaggagagcagaccaaggcactggtcactcagctcacactcttcaaccagatc
ctagtggagctccgggatgacatccgggaccaggtgaaggaaatgtccctcatccggaac
accatcatggagtgtcaggtgtgcggtttccacgagcagcgttcacactgcagccccagc
ccctgcttcagaggtgtggactgcatggaagtgtatgagtacccagggctacgctgtggg
ccctgcccacctggcctgcgcggcaatggcacccactgtgaagacatcgacgaatgtgct
cacgctgacccctgtttcctggggtccagctgcatcaacaccatgcctggcttccactgc
gaggcctgtcctcaagggtacaagggcacccgagtgtctggagtgggcattgactatgct
agagccagcaaacaggtctgcagtgacattgacgaatgtaacgacggtaacaatggaggc
tgtgacccaaattccatctgcaccaacactgtggggtctttcaaatgtggtccctgccgc
ctgggtttcctggggaaccagagccagggctgcactccagccaggacgtgccacagcccc
gcccacagcccctgccacatccacgctcattgtctttttgaacgcaacggtgcagtgtca
tgccagtgtaacgtgggctgggcagggaacgggaacgtgtgtggacctgacacggacata
gacggctatccagaccaggcgcttccctgcatggacaacaacaaacactgcaagcaggac
aattgccttttgacacccaactctgggcaagaagatgctgataatgatggtgtcggggac
cagtgtgatgacgacgctgatggggatggtatcaagaatgttgaggacaactgccgactg
ttccccaacaaggaccagcagaattcagacacagattcatttggtgacgcctgtgacaac
tgtcccaatgttcccaacaatgaccagaaggacacggatggcaatggagaaggagacgcc
tgtgacaacgatgtggacggggacggcatccccaatggcttggacaattgccctaaagta
cccaacccactgcagacagaccgggatgaagatggagtcggagacacttgcgacagctgc
cctgagatgagcaatcctacccagacagatgcagacagtgacctggtaggggatgtctgt
gacaccaacgaagacagcgatggagacgggcaccaggacaccaaggacaactgtcctcag
ctgcccaacagctctcagctggactcggacaacgacgggcttggagatgagtgtgacagc
gacgatgacaatgacggggtgcccgattacgtgcctcccgggcctgataactgtcgcctg
gtacccaatcctaaccagaaggactcagacggcaacggtgttggtgatgtctgtgaggat
gactttgacaatgatgcagtggttgaccctctggatgtgtgcccagaaagtgcagaagtt
accctcacggacttccgggcctatcagaccgtgattctggatccggagggtgacgctcag
atcgatccaaactgggtagtgctcaaccagggcatggaaattgttcagactatgaacagt
gacccaggtcttgcagttggatacacagccttcaatggtgtagactttgaaggcactttc
cacgtgaacacagtcactgatgatgactatgcaggcttcctcttcagttaccaggacagt
ggccgcttctatgtggtcatgtggaaacagacggagcagacctactggcaggccacgcct
ttccgagcagtggcccaaccagggctgcagctcaaggcagtgacatcaatatctggccca
ggtgagcacctccggaatgctctgtggcacactggccacacccctgatcaggtacgactg
ctgtggactgatccacggaatgtgggttggcgagacaagacatcctatagatggcggctg
ctccaccggccccaagtcggctacattcgggtgaagctctatgagggtccccagctagtg
gcggactctggggtgattattgatacgtccatgcgaggggggcgtcttggtgtattctgc
ttctcccaagaaaacatcatttggtctaatctccagtaccgatgcaatgacacagtgcct
gaggactttgagccattcaggaggcaactgctccagggaagggtgtga

DBGET integrated database retrieval system