KEGG   Rattus norvegicus (rat): 681309Help
Entry
681309            CDS       T01003                                 

Gene name
Thbs3
Definition
(RefSeq) thrombospondin 3
  KO
K04659  
thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    681309 (Thbs3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    681309 (Thbs3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    681309 (Thbs3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    681309 (Thbs3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    681309 (Thbs3)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Phagocytosis
   Opsonins
    681309 (Thbs3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   681309 (Thbs3)
  Exosomal proteins of colorectal cancer cells
   681309 (Thbs3)
  Exosomal proteins of bladder cancer cells
   681309 (Thbs3)
Cell adhesion molecules and their ligands [BR:rno04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     681309 (Thbs3)
  Beta3 integrins
   alpha IIb  beta 3
    ITGB3; integrin beta 3 [KO:K06493]
     681309 (Thbs3)
   VNR
     681309 (Thbs3)
 7. Others
  SDC4; syndecan 4 [KO:K16338]
   681309 (Thbs3)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   681309 (Thbs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 955 aa AA seqDB search
MEKPELWVALALLLCSYTCGSQDLQVIDLLTVSESRQMAAVAEKVRTALLTAGDIYLLST
FRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADGR
THTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPAEVSGLEIRTGQKAYLRMQ
GFVESMKIILGGSMARVGALSECPFQGDESIHNAVTSALQSILGEQTKALVTQLTLFNQI
LVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPSPCFRGVDCMEVYEYPGYRCG
PCPPGLRGNGTHCEDIDECAHADPCFLGSSCINTMPGFHCEACPQGYKGTRVSGVGIDYA
RASKQVCSDIDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCTPARTCHSP
AHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPDTDIDGYPDQALPCMDNNKHCKQD
NCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDN
CPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDTCDSC
PEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDS
DDDNDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAEV
TLTDFRAYQTVILDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTF
HVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSISGP
GEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWRLLHRPQVGYIRVKLYEGPQLV
ADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRV
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccggaactttgggttgccctggctctcctcctttgctcttacacatgtggc
agtcaggaccttcaggtaattgacctgctgacggtgagtgagtccaggcagatggcagct
gtagcagagaaggtccggacagctttactcactgctggggacatctacctcttgtccact
ttccgcctccctccaaagcaaggtggtgtcctctttggcctctactctcgccaagacaac
acacgatggctggaggcctctgttgttggcaagatcaacaaagtgctggtgcggtaccag
cgggaagatggcaaagtgcacgcagtgaaccttcagcaagcaggcttggctgacgggcgc
acgcacaccgctctcctgcgactccgaggaccttctcgacccagccctggcctgcaactg
tatgtggactgtaaactgggtgaccaacacgctggcctcccagccctagcgcccattcct
ccagcggaggtcagcggactggagattagaacaggacaaaaggcttacctgaggatgcag
ggctttgtggaatcgatgaagattattttgggtggatcgatggctcgggtgggagccctg
agcgaatgtccgttccaaggagatgaatccattcacaatgcagtgaccagcgcgctgcag
tccattctaggagagcagaccaaggcactggtcactcagctcacactcttcaaccagatc
ctagtggagctccgggatgacatccgggaccaggtgaaggaaatgtccctcatccggaac
accatcatggagtgtcaggtgtgcggtttccacgagcagcgttcacactgcagccccagc
ccctgcttcagaggtgtggactgcatggaagtgtatgagtacccaggctaccgctgtggg
ccctgcccacctggcctgcgcggcaatggcacccactgtgaagacatcgacgagtgtgct
cacgctgacccctgtttcctggggtccagctgcatcaacaccatgcctggcttccactgc
gaggcctgtcctcaagggtacaagggcacccgagtgtctggagtgggcattgactatgct
agagccagcaaacaggtctgcagtgacattgacgaatgtaacgacggtaacaatggaggc
tgtgacccaaattccatctgcaccaacactgtggggtctttcaaatgtggtccctgccgc
ctgggtttcctggggaaccagagccagggctgcactccagccaggacgtgccacagcccc
gcccacagcccctgccacatccacgctcattgtctttttgaacgcaacggtgcagtgtca
tgccagtgtaacgtgggctgggcagggaacgggaacgtgtgtggacctgacacggacata
gacggctatccagaccaggcgcttccctgcatggacaacaacaaacactgcaagcaggac
aattgccttttgacacccaactctgggcaagaagatgctgataatgatggtgtcggggac
cagtgtgatgacgacgctgatggggatggtatcaagaatgttgaggacaactgccgactg
ttccccaacaaggaccagcagaattcagacacagattcatttggtgacgcctgtgacaac
tgtcccaatgttcccaacaatgaccagaaggacacggatggcaatggagaaggagacgcc
tgtgacaacgatgtggacggggacggcatccccaatggcttggacaattgccctaaagta
cccaacccactgcagacagaccgggatgaagatggagtcggagacacttgcgacagctgc
cctgagatgagcaatcctacccagacagatgcagacagtgacctggtaggggatgtctgt
gacaccaacgaagacagcgatggagacgggcaccaggacaccaaggacaactgtcctcag
ctgcccaacagctctcagctggactcggacaacgacgggcttggagatgagtgtgacagc
gacgatgacaatgacggggtgcccgattacgtgcctcccgggcctgataactgtcgcctg
gtacccaatcctaaccagaaggactcagacggcaacggtgttggtgatgtctgtgaggat
gactttgacaatgatgcagtggttgaccctctggatgtgtgcccagaaagtgcagaagtt
accctcacggacttccgggcctatcagaccgtgattctggatccggagggtgacgctcag
atcgatccaaactgggtagtgctcaaccagggcatggaaattgttcagactatgaacagt
gacccaggtcttgcagttggatacacagccttcaatggtgtagactttgaaggcactttc
cacgtgaacacagtcactgatgatgactatgcaggcttcctcttcagttaccaggacagt
ggccgcttctatgtggtcatgtggaaacagacggagcagacctactggcaggccacgcct
ttccgagcagtggcccaaccagggctgcagctcaaggcagtgacatcaatatctggccca
ggtgagcacctccggaatgctctgtggcacactggccacacccctgatcaggtacgactg
ctgtggactgatccacggaatgtgggttggcgagacaagacatcctatagatggcggctg
ctccaccggccccaagtcggctacattcgggtgaagctctatgagggtccccagctagtg
gcggactctggggtgattattgatacgtccatgcgaggggggcgtcttggtgtattctgc
ttctcccaagaaaacatcatttggtctaatctccagtaccgatgcaatgacacagtgcct
gaggactttgagccattcaggaggcaactgctccagggaagggtgtga

DBGET integrated database retrieval system