KEGG   Rattus norvegicus (rat): 681458Help
Entry
681458            CDS       T01003                                 

Definition
similar to stearoyl-coenzyme A desaturase 3
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rno01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:rno01040]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:rno03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1
AA seq 350 aa AA seqDB search
MTPSYTTTSTITEPPSGVMQKGKEKLKTLPLYLEEDIRPEMREDIHDPSYQDEEGPPPKL
EYVWRNIILMALLHVGALYGITLIPSSKVYTLLWAFIYYAISIEGIGAGVHRLWSHRTYK
ARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFTETHADPHNSRRGFFFSHVGWLLVRK
HPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLLCFILPTLVPWYFWGETFLHSFYVA
TLLRYAVVLNVTWLVNSAAHLYGYRPYDKNIDPRENALVSLGTLGEGFHNYHHAFPYDYS
ASEYPWHINFTTFFIDCMAFLGLAYDRKRVSKATVLARIKRTGDGSHKSG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactccttcatacacaaccacctccaccatcacagagcctccctctggagtcatgcag
aaaggaaaagaaaaattaaagactctgcccctctacctggaagaagacatccgtcctgaa
atgagagaagatatccacgaccccagctaccaggatgaggaggggcccccgcccaagctg
gagtacgtctggaggaacatcatcctcatggccctgctgcacgtgggagccctgtacggg
atcacactgatcccctcctccaaggtctacaccttgctctgggcattcatctactatgcg
atcagtattgagggcattggagctggagttcatcgcttgtggagccacaggacttacaag
gctcgcctgcccctgagaatcttcctcatcattgccaacaccatggctttccagaacgat
gtgtatgaatgggcccgggatcaccgcgcccaccacaagttcacagaaacacacgccgac
cctcacaactcccgccgtggctttttcttctctcacgtgggttggctgcttgtgcgcaaa
cacccggctgtcaaagagaagggcggaaagctggacatgtctgacctaaaagctgagaag
ctggtgatgttccagaggaggtactacaagcccggcatcctgctcttgtgcttcatcctg
cccacgctggtgccctggtatttctggggtgaaacttttctacacagtttttatgttgcc
accttactgagatatgccgtagtgctcaacgtcacctggctggtgaacagtgccgcccac
ctctatggatatcgcccctacgacaagaacattgatccccgggagaatgccctggtttcc
ttggggactctgggcgagggcttccacaactaccatcacgccttcccctacgactactct
gccagtgagtacccctggcacatcaacttcaccacgttcttcatcgactgcatggctttc
ctaggcctggcttacgaccggaagagggtgtccaaggccactgtcttagccaggattaag
agaactggagatgggagccacaagagtggctga

DBGET integrated database retrieval system