KEGG   Rattus norvegicus (rat): 681458Help
Entry
681458            CDS       T01003                                 

Definition
similar to stearoyl-coenzyme A desaturase 3
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    681458
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    681458
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    681458
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    681458
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     681458
Lipid biosynthesis proteins [BR:rno01004]
 Desaturase
  First
   681458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1
AA seq 350 aa AA seqDB search
MTPSYTTTSTITEPPSGVMQKGKEKLKTLPLYLEEDIRPEMREDIHDPSYQDEEGPPPKL
EYVWRNIILMALLHVGALYGITLIPSSKVYTLLWAFIYYAISIEGIGAGVHRLWSHRTYK
ARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFTETHADPHNSRRGFFFSHVGWLLVRK
HPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGILLLCFILPTLVPWYFWGETFLHSFYVA
TLLRYAVVLNVTWLVNSAAHLYGYRPYDKNIDPRENALVSLGTLGEGFHNYHHAFPYDYS
ASEYPWHINFTTFFIDCMAFLGLAYDRKRVSKATVLARIKRTGDGSHKSG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgactccttcatacacaaccacctccaccatcacagagcctccctctggagtcatgcag
aaaggaaaagaaaaattaaagactctgcccctctacctggaagaagacatccgtcctgaa
atgagagaagatatccacgaccccagctaccaggatgaggaggggcccccgcccaagctg
gagtacgtctggaggaacatcatcctcatggccctgctgcacgtgggagccctgtacggg
atcacactgatcccctcctccaaggtctacaccttgctctgggcattcatctactatgcg
atcagtattgagggcattggagctggagttcatcgcttgtggagccacaggacttacaag
gctcgcctgcccctgagaatcttcctcatcattgccaacaccatggctttccagaacgat
gtgtatgaatgggcccgggatcaccgcgcccaccacaagttcacagaaacacacgccgac
cctcacaactcccgccgtggctttttcttctctcacgtgggttggctgcttgtgcgcaaa
cacccggctgtcaaagagaagggcggaaagctggacatgtctgacctaaaagctgagaag
ctggtgatgttccagaggaggtactacaagcccggcatcctgctcttgtgcttcatcctg
cccacgctggtgccctggtatttctggggtgaaacttttctacacagtttttatgttgcc
accttactgagatatgccgtagtgctcaacgtcacctggctggtgaacagtgccgcccac
ctctatggatatcgcccctacgacaagaacattgatccccgggagaatgccctggtttcc
ttggggactctgggcgagggcttccacaactaccatcacgccttcccctacgactactct
gccagtgagtacccctggcacatcaacttcaccacgttcttcatcgactgcatggctttc
ctaggcctggcttacgaccggaagagggtgtccaaggccactgtcttagccaggattaag
agaactggagatgggagccacaagagtggctga

DBGET integrated database retrieval system