KEGG   Rattus norvegicus (rat): 682967Help
Entry
682967            CDS       T01003                                 

Gene name
Tmx3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     682967 (Tmx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
18
AA seq 470 aa AA seqDB search
MSLRALITGFTPRSMANAAGRRSWAALRLCAAVILLDLAVCKGFVEDLNESFKDNRKDDI
WLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIK
LLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFDHVRKRHRVFFVYIGGESPL
KEKYIDAASELIVYTYFFSASEDVVPEYVTLKEMPAVLVFKDDTYFVYDEYEDGDLSSWI
SRERFQNYLTMDGFLLYELGDTGKLVAIAVIDEKNTSLEHTRLKSIIQEVARDFRDHFHR
DFQFGHMDGNDYINTLLMDELTVPTIVVLNTSNQQYFLLDRHIKDASDMVQFINSILDGT
VPAQGGDSIFQRLKRIVFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDG
GYIEERYEVSKSEMENQEQIEESKEQESSSGGSLVPTVQESKDVLEKKKD
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgcgcgcgctcatcacgggattcacgccgcgctccatggcgaatgcagcgggg
cggaggagctgggcggccctccggctctgcgctgccgttattttacttgatctggctgtc
tgtaaaggatttgtagaagatctaaatgaatcatttaaagataatcgaaaagatgacatt
tggcttgttgatttttatgcaccctggtgtggccattgtaaaaaactggaaccaatttgg
aatgaagttgggcttgaaatgaaaagtattggttctccagttaaagttggaaagatggat
gctacttcgtattctagcattgcttcagagtttggagttcgaggttatccaacaattaag
ctattaaagggagacttggcatataattacagaggaccacggaccaaagatgatataatt
gagtttgctcacagagtgtctggggctctaattcggcctcttccaagtcaacaaatgttc
gaccatgtacggaagaggcaccgtgtattttttgtttatattggtggagaatcacccttg
aaagagaaatacatagatgctgcttcagagttaattgtatatacgtacttcttttctgcc
tcagaagatgtggttcctgagtacgtgacactgaaggagatgcctgctgtgcttgttttc
aaagatgacacttactttgtttacgatgagtatgaagatggagatctgtcctcatggatc
agcagggagaggtttcagaactatcttactatggatggtttccttttgtatgaacttgga
gacacaggaaagcttgtggccattgcagttattgatgagaaaaacacatcactcgagcat
accagattaaagtcaattattcaggaagttgctagagatttcagagaccacttccataga
gattttcagtttggccatatggatggaaatgactatataaacaccttgctgatggacgag
ttgacggtcccaaccatagttgtactgaatacttcaaaccaacagtactttttgctagat
agacatattaaggatgccagcgacatggtccagttcattaacagcattttggatggtaca
gtaccagcccaaggaggtgatagcatttttcagagattgaaaagaatagtatttgatgcc
aaatctacaattgtgtctatattcaagagctctccacttatgggctgctttcttttcggg
ctgccactgggtgtcatcagtatcatgtgctatggaatctatacagctgacacagatgga
ggctatatagaagaacgatatgaagtgtccaaaagtgaaatggaaaaccaggaacagata
gaagagagcaaagagcaggaatccagcagtggagggtctctagtgcctactgtgcaagag
tccaaagatgtattagaaaagaagaaagattga

DBGET integrated database retrieval system