KEGG   Rattus norvegicus (rat): 684444Help
Entry
684444            CDS       T01003                                 

Definition
similar to HIStone family member (his-41)
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    684444
  Immune diseases
   05322 Systemic lupus erythematosus
    684444
  Substance dependence
   05034 Alcoholism
    684444
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2
AA seq 123 aa AA seqDB search
MAKPILKRYRYIKGHLRPLYRKHLRCSSIHFGHGNYSLYINRVLKEVVPKRGISSHTVDI
MNLMINDIFERIATEACQRMNLRKRCTLTSEDIQKAVYMLMPKKLAKLAVTFGSKAVHRF
IHS
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccatcctcaaaagataccgctacatcaaaggacatctaagaccattgtat
agaaagcatttacggtgctctagcatccattttggccatggaaattactccctttacata
aacagagtcctgaaggaagttgtccccaagagaggtatatcatctcatactgtggacatc
atgaacctcatgatcaatgacatcttcgaacgcattgctacggaagcctgccagaggatg
aacctcagaaagcgctgtaccctcacctcagaagatatccagaaggcagtgtatatgttg
atgccgaagaagctggctaaacttgctgtgactttcggaagtaaagcagtccacagattc
atccattcctaa

DBGET integrated database retrieval system