KEGG   Rattus norvegicus (rat): 684797Help
Entry
684797            CDS       T01003                                 

Definition
(RefSeq) similar to Histone H2B 291B
  KO
K11252  histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    684797
  Immune diseases
   05322 Systemic lupus erythematosus
    684797
  Substance dependence
   05034 Alcoholism
    684797
Chromosome [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    684797
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   684797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 684797
NCBI-ProteinID: XP_001071972
RGD: 1586699
UniProt: G3V8B3
Position
17p11
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagcctgcgaaatccgctcccgccccgaagaagggctccaagaaggccgttacc
aaggcccagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagttattctgtc
tacgtgtacaaggttctgaagcaagtgcacccggacactggtatctcttccaaggccatg
ggcatcatgaactcattcgtgaacgacatcttcgaacgcatcgcgggcgaggcgtcgcgt
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgcggtgtccgagggcaccaaggccgtcacc
aaatacaccagctccaagtga

DBGET integrated database retrieval system