KEGG   Rattus norvegicus (rat): 685539Help
Entry
685539            CDS       T01003                                 

Gene name
Gtf3c4
Definition
general transcription factor IIIC, polypeptide 4 (EC:2.3.1.48)
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p12
AA seq 818 aa AA seqDB search
MSEADQARVGPKADEPSSPAEEKDEGGGKEAAADAAPGPSASFRLMVTRREPAVKLQYAV
SGLEPLSWSEDHRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGSKT
EVAECKEKFASSKDPTISQTFMLDRMFNPEGKALPPMRGFKYTSWSPMGCDANGRCLLAA
LTMDNRLTVQVNLNRLQWVQLVDLTEIYGDRLYETSYRLSKNEAPEGNLGDFAEFQRRHS
MQTPVRMEWSSICTTQQVKHNNECRDVSSVLLAVLFENGNIAVWQFQLPFVGKESISSCN
TIESGISSPSVLFWWEYEHSNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVVLWK
EMDKLPVHSIKCVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSL
PIVSITADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSP
CGAYLAIITTEGMVNGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLIDLVR
WKILKDKHIPQFLHEALEKKIESSGVTYFWRFKLFLLRILYQSMQKSPSEALWKPTHEDS
KILLVDSPGMGDGEDEQQEEGTSKQGTKAGLQEKSKEGGDTEETPEDSLTAVGDTGGREP
IEEKLLEIQGKIEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEDYDD
RTAQVLIGHISKKMNKQTFPERCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLI
YRRCLLHDSIARHPVPEDPDWIKRLLQSPCPFCDSPVF
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcggaccaagcccgggtggggcccaaggccgacgaaccttcgtcgcccgca
gaggagaaggacgaagggggcgggaaggaggcggctgccgacgcggccccggggcccagc
gcctcgtttcgcctcatggtgactcggcgggagcctgccgtgaagctgcagtacgctgtg
agcgggttggagccgctctcctggtctgaggaccaccgtgtgtctgtgtccacggcccgc
agcatcgccgtgctagagcttatctgcgatgtgcacaacccaggccaggacctggtgatc
caccgcacctcggtacccgctcctctcaacagctgcctcctcaaggttggctcgaaaaca
gaagttgctgagtgcaaggaaaagtttgcttcctctaaagaccccaccatcagccagact
ttcatgctggacaggatgttcaaccctgaggggaaggcattgcccccaatgcggggtttc
aaatacactagctggtctcccatgggttgtgatgcaaatggcaggtgcctcttggcagcg
ctgaccatggacaatcgcctgaccgtgcaggtaaacctcaacagactccaatgggttcag
ctggttgatctgactgagatttatggagaccgtctttatgagaccagttatagactgtct
aaaaatgaggctcctgagggaaaccttggggattttgctgagtttcagaggagacacagc
atgcagaccccagtcagaatggaatggtcgagtatctgtaccactcagcaggtcaagcac
aacaacgagtgccgggatgtgagcagcgtgctcctggccgtcctctttgagaacgggaat
atagctgtgtggcagttccagctgccgtttgtgggcaaggagtccatctcttcgtgcaac
actattgagtcaggaatcagctcccccagtgtcttgttttggtgggaatatgagcacagc
aataggaagatgagtggccttattgtaggcagtgcttttggacccgtaaaaattctccct
gtcaatctcaaagcagtcaaaggctactttactttacggcagcctgttgtcttgtggaaa
gagatggacaagttgcctgtgcacagcatcaaatgtgtgccactttatcacccttaccag
aagtgtagctgtagcttagtggtggccgcaagaggctcctatgtgttctggtgtcttctt
ctgatctccaaggcgggtctgaatgttcacaattcccacgtcacaggccttcactcgctg
cccatcgtctccattaccgcagacaagcagaacggaaccgtgtacacctgctctagtgac
ggaaaggtgaggcagttgattcccatcttcacagatgttgcattaaaatttgaacaccag
ctgattaagctctcagatgtatttggctcagtgaggactcacggcattgcagtgagcccc
tgtggtgcttacctggccatcatcaccactgagggcatggtcaatggcctccatccagtg
aacaagaactaccaggttcagtttgttactctcaagacctttgaagaggcagctgctcag
ctcttggagtcttcagttcagaatctctttaagcaggtagacttgattgacttagtccgc
tggaaaattttaaaagataaacatattcctcagtttttacatgaagctttggaaaaaaag
attgaaagcagtggggttacctatttttggcgttttaagcttttcctcctaaggattttg
tatcagtcaatgcagaaatccccatccgaggccttatggaaacccacccatgaggactca
aaaatcttactggttgactcacctgggatgggcgatggtgaggatgagcagcaagaggaa
ggtacttccaagcaggggacgaaggctggcctgcaggagaagagcaaagagggtggtgac
acggaggagactcctgaggattcactcactgccgtgggagacaccggaggccgtgaaccc
atagaggagaagctccttgagatccaagggaagattgaggctgtggagatgcacctgacc
agggagcacatgaagcgggtcctcggagaagtgtacctgcacacctggatcacggagaac
accagcatccccaccagagggctctgcaactttctcatgtctgatgaagattatgatgac
agaacagcacaggtcttgattggacatatctccaagaagatgaacaagcagaccttccct
gagcgctgcagtctgtgtaaggagatcttaccattcacagatcgcaagcaagctgtttgt
tccaatgggcacatctggctccggtgctttctaacctaccagtcctgccagagcttgatc
tacaggcggtgtttgctccatgacagcatcgccaggcaccctgttccagaagatcctgac
tggattaagaggttgctgcagagtccttgtcctttctgtgattctcctgtcttctga

DBGET integrated database retrieval system