KEGG   Rattus norvegicus (rat): 686104Help
Entry
686104            CDS       T01003                                 

Gene name
Eif4e1b
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  
translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    686104 (Eif4e1b)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    686104 (Eif4e1b)
   04151 PI3K-Akt signaling pathway
    686104 (Eif4e1b)
   04150 mTOR signaling pathway
    686104 (Eif4e1b)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    686104 (Eif4e1b)
  Aging
   04211 Longevity regulating pathway - mammal
    686104 (Eif4e1b)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    686104 (Eif4e1b)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     686104 (Eif4e1b)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     686104 (Eif4e1b)
Translation factors [BR:rno03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    686104 (Eif4e1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Position
17p14
AA seq 269 aa AA seqDB search
MAASEIMSKAEGEGQEEEEEEEEEEEKEEEEEEEEEEKEEEEEEEVKEKPSEATAEGLQG
EARDLPGSLKTVKQKAQREHPTKLPRELHPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDT
VEDFWATYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELDR
LWLETLLCLLGESFEEYSGEVCGAVVNIRTKGDKIALWTSEAENKAGVMHIGHIYKERLG
LSTKTIIGYQAHADTAAKSNSLAKNKFVV
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttctgaaattatgagcaaagctgagggtgaagggcaggaggaggaagaggag
gaagaagaggaagaggagaaggaagaggaggaggaagaagaggaagaggagaaggaagag
gaagaggaggaggaggtgaaagaaaagccatcagaagcaacagcggagggactccaagga
gaagccagagacctacctggatcccttaagaccgtgaagcagaaggcccagagagaacat
ccaaccaagctcccgagggagctgcaccccctgcagttcaggtgggttctgtggttcttc
aagaatgatcgaagccgggcctggcaggacaatctgcagttagtcaccaagtttgacact
gtggaggacttctgggcgacgtaccgccacgtcaagctggccagtaagctctcttgtggc
tgtgactacgctctgttcaaggaaggcatccaacccatgtgggaagacagcagaaacaag
cggggtggccgctggctgctcagtcttgccaaacagcagcgccacatggaactggaccgt
ctgtggctggagacattgctgtgtctactcggggagagttttgaggagtacagcggggaa
gtgtgtggcgccgtcgtcaacatccgcaccaagggggacaagattgccctgtggacaagt
gaagcagagaacaaggccggtgtgatgcacatcgggcatatatacaaagagcgcctgggc
ctctccacgaagaccatcattgggtaccaggcccatgcagacactgcggctaagagcaac
tctttagccaagaacaagtttgtggtgtga

DBGET integrated database retrieval system