KEGG   Rattus norvegicus (rat): 686104Help
Entry
686104            CDS       T01003                                 

Gene name
Eif4e1b
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:rno03013]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:rno04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:rno04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:rno04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
17p14
AA seq 263 aa AA seqDB search
MSKAEGEGQEEEEEEEEEEEKEEEEEEEEEEKEEEEEEEVKEKPSEATAEGLQGEARDLP
GSLKTVKQKAQREHPTKLPRELHPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDTVEDFWA
TYRHVKLASKLSCGCDYALFKEGIQPMWEDSRNKRGGRWLLSLAKQQRHMELDRLWLETL
LCLLGESFEEYSGEVCGAVVNIRTKGDKIALWTSEAENKAGVMHIGHIYKERLGLSTKTI
IGYQAHADTAAKSNSLAKNKFVV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagctgagggtgaagggcaggaggaggaagaggaggaagaagaggaagaggag
aaggaagaggaggaggaagaagaggaagaggagaaggaagaggaagaggaggaggaggtg
aaagaaaagccatcagaagcaacagcggagggactccaaggagaagccagagacctacct
ggatcccttaagaccgtgaagcagaaggcccagagagaacatccaaccaagctcccgagg
gagctgcaccccctgcagttcaggtgggttctgtggttcttcaagaatgatcgaagccgg
gcctggcaggacaatctgcagttagtcaccaagtttgacactgtggaggacttctgggcg
acgtaccgccacgtcaagctggccagtaagctctcttgtggctgtgactacgctctgttc
aaggaaggcatccaacccatgtgggaagacagcagaaacaagcggggtggccgctggctg
ctcagtcttgccaaacagcagcgccacatggaactggaccgtctgtggctggagacattg
ctgtgtctactcggggagagttttgaggagtacagcggggaagtgtgtggcgccgtcgtc
aacatccgcaccaagggggacaagattgccctgtggacaagtgaagcagagaacaaggcc
ggtgtgatgcacatcgggcatatatacaaagagcgcctgggcctctccacgaagaccatc
attgggtaccaggcccatgcagacactgcggctaagagcaactctttagccaagaacaag
tttgtggtgtga

DBGET integrated database retrieval system