KEGG   Rattus norvegicus (rat): 687001Help
Entry
687001            CDS       T01003                                 

Gene name
Hdac9, RGD1310748, RGD1563092
Definition
histone deacetylase 9 (EC:3.5.1.98)
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    687001 (Hdac9)
  Substance dependence
   05034 Alcoholism
    687001 (Hdac9)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     687001 (Hdac9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 1068 aa AA seqDB search
MHSMISSVDVKSEVPMGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKLQQELLAIKQQQELLEKEQKLEQQRQEQEVER
HRREQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVGRHPKLWY
TAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDTKDDFPLRKTASEPNLKVRSRLKQKVAER
RSSPLLRRKDGNLVTSFKKRVFEVAESSVSSSSPGSGPSSPNNGPAGNVTENEASVLPPT
PHPEQLVPQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSPLSASNSLKDKQKCETQM
LRQGVPLPGQYGSGIAASSSHAHVAMEGKPNSSHQALLQHLLLKEQMRQQKLLVAGGVPL
HPQSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQY
QQQIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMEERATSKDSGTGKDSSACVEDTL
GQVGAVKVKEEPVDSDEDAQMQEMECGEQAAFMQQTPLLESSHTRALSVHQARLAAAGID
GLEKHGLLSRTHSSPAPSMSPHPAADCPRQPASATGIAYDCLMLKHQCICGNSTTHPEHA
GRIQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTSPLDGQKLDPRTLL
GDDSRKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVR
PPGHHAEESAAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSIL
YISLHRYDEGNFFPGSGAPNEVGVGLGEGYNVNIAWTGGLDPPMGDVEYLEAFRTVVMPV
AREFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLANGRVALALEGGHDL
TAICDASEACINALLGNEPGSLEEDVLHQSVNTNAAASLQKTIEIQSKYWKSIKMVAVAR
GCALPASQLQEETETVSALASLTVDVEQPFAQEDGRTAGEPMEEEPAL
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggacgtgaaatcagaggttcctatgggactggagccc
atctcacctttagacctaaggacagacctcaggatgatgatgcctgtggtggatcctgtc
gtccgcgagaagcaactgcagcaagagttacttcttatccaacagcagcagcaaatccag
aagcagctcctgatagccgagtttcagaagcagcacgagaatttgacaaggcagcatcaa
gcacaacttcaggagcacatcaagttacaacaggaacttctagccataaaacaacagcaa
gaactcctagaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagagg
catcgcagagagcagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcg
gtggcaagcacagaggttaagcagaagcttcaagaattcctattgagtaaatcagcaacg
aaagacactccaaccaatggaaagaatcattccgtgggccgccatcccaagctctggtac
acggctgcccaccacacatcactggatcaaagctctccacccctcagtggaacgtctcca
tcctacaaatacacattaccaggagcccaagataccaaggatgatttccccttgcgaaaa
acagcctcagagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagagg
agaagcagccccttactcaggcggaaggatggaaatcttgtcacttcattcaagaagcga
gtgtttgaggtggcagaatcctcggtcagtagcagctctccagggtcaggtcccagttca
ccaaacaatgggcctgctggaaatgttaccgaaaacgaggcttcagttctgcctcccacg
cctcaccccgagcagctggttccacagcagcgcattctgattcacgaagattccatgaac
ctgctgagtctctacacctccccgtccctgcccaatatcaccctgggacttccagcagtg
ccatccccactcagtgcttctaattccctcaaagacaagcagaagtgtgagacacagatg
ctcagacaaggtgtccctctgcccggccagtatggaagtggcattgcagcatcctccagc
catgctcatgtagcaatggagggcaaaccgaacagcagtcaccaagctctcctgcagcac
ctcctgctgaaggaacaaatgagacagcaaaagcttcttgtggctggcggagttccatta
cacccccagtctcctttggcaacaaaagaaagaatttcaccaggcattagaggtacccac
aaattgccccgccacagacccctcaatcgaactcagtctgcacctttgcctcagagcaca
ctggctcagctggtcattcagcagcagcaccagcagttcctggagaagcagaagcaatac
cagcagcagatccacatgaacaaactgctatcgaaatctattgagcaactgaagcaacca
ggcagccatcttgaagaggcagaggaggagcttcagggggaccaagccatggaagagaga
gcaacgtctaaggacagcggtaccgggaaggacagcagtgcttgtgtggaggacacactg
ggacaagttggggctgtgaaggtcaaggaggaacccgtggacagcgacgaagatgctcag
atgcaggaaatggaatgtggggagcaggctgcttttatgcaacagacgcccttgctggag
tcctcacacacgcgtgcactctcagtgcaccaggctcggctggctgcagctggcatcgat
ggattagagaaacatggactcctctccaggacccattcttctcctgcaccctccatgtca
cctcacccagccgcagactgtccccgccagcctgcctctgccactggaattgcctatgac
tgtctgatgctgaaacaccagtgcatctgtggcaattccaccacccaccctgagcatgct
gggcgaatacagagcatctggtcacggctgcaagaaaccgggctgctaaataaatgtgag
cgaattcaaggtcgaaaagccagcctggaggaaattcagcttgttcattctgaacatcac
tcactactgtatggcaccagccccctggacggacagaagctggaccccaggacactccta
ggtgatgattctcgaaaattcttttcctcgttaccttgtggtggactcggggtggacagt
gacaccatttggaatgagctgcactcgtccggtgctgcacgcatggctgttggctgtgtc
attgagctggcttccaaagtggcctcaggagagctgaagaatgggtttgctgttgtgagg
cccccaggccatcatgctgaagaatctgcagccatggggttctgcttttttaattcagtc
gcaattacggccaaatacttgagagaccaactaaatataagcaagatattgatcgtagat
ctggatgttcaccatggaaacggtacacagcaggccttttatgctgaccccagcatcctg
tacatttcactccatcgctatgatgaagggaactttttccctggcagtggcgccccgaat
gaggttggagtaggtctgggagaaggctacaatgtaaacattgcctggacaggcggcctt
gacccccctatgggagatgttgagtaccttgaagcattcaggactgtcgtgatgcctgtg
gccagagagtttgatccagacatggtcctggtttctgctggatttgatgcattggaaggc
cacacccctcccctagggggttacaaagtgacagcaaaatgctttggtcatttgacgaag
cagctgatgacattggctaatggacgtgtggcattggctcttgaagggggacatgatctg
acagccatctgtgatgcctcggaggcctgcataaatgcccttctaggaaatgagcccggg
tctcttgaggaagatgttctccaccagtctgtgaatacgaatgcagccgcttctttacag
aagaccattgaaatccaaagcaagtattggaagtcgatcaagatggtggctgttgcaagg
ggctgtgctctgcctgcttctcagctgcaagaggagacagagaccgtttctgcattagcc
tccctgacggtagatgtggaacagccatttgctcaggaagatggcagaactgctggtgag
cccatggaagaggagccagccttgtga

DBGET integrated database retrieval system