KEGG   Rattus norvegicus (rat): 687696Help
Entry
687696            CDS       T01003                                 

Gene name
Stambpl1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1
AA seq 436 aa AA seqDB search
MEQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNISINEDITPRRYFRSGVEMER
MASVYLEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKTDLLRKYNIEYQEYLQSKNKYKAEILKKLEHQRLIEAERQRIAQMRQQQLESEQFLFF
EDQLKKQELARGQTRGQDSLVLSEQTDGSGLSCFSTHQNNSLRNVFADHPQKSDVCDLAN
YSPPVNRALKPAATLSAVQNLVVEGLRCVVLSRDLCHKFLLLADSNTVRGIETCGILCGK
LTHNEFTITHVVVPKQSAGPDYCDVENVEELFSVQDQHGLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSTCKKKGFHPHTKDPKLFSIC
SHVLVKDIKTTVLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccatttacggtgaattcactgaaaaagttagctgctatgcctgaccataca
gatgtttctctaagtccagaggagcgggtccgtgccctaagcaagcttggttgtaatatc
tccattaatgaagacatcaccccacgccgttacttcaggtccggagtggaaatggaaaga
atggcgtctgtgtatttggaagaagggaacctggaaaatgcctttgttctttacaacaaa
tttataacattatttgtagaaaaacttcccagccatcgagattaccagcagtgtgcagtt
cccgagaagcaggacatcatgaagaaactgaaggagattgcgttcccaaggacggacgaa
ttgaaaacggacctgctaaggaaatataacatagaataccaagagtatttacaaagtaaa
aacaaatataaagccgaaattctcaaaaagttggaacatcagagactgatagaggcagag
cgccagcgaatcgctcagatgcgccagcagcagctggagtctgaacagttcctgtttttc
gaagatcaactcaagaagcaggagttggctcggggccagactcgaggtcaggactctctg
gtgctgtctgagcagactgacggaagtgggctgtcctgtttttccacccaccagaacaat
tcactgaggaacgtatttgcagaccatcctcagaaaagtgatgtttgcgatctcgctaac
tactctcctccagtgaacagggccctaaagccagcggccaccctgagtgctgttcagaat
ttagtggttgaaggactgaggtgtgtagttttgtcaagagatctttgccacaaatttctg
ctgctggctgactctaacacagtgagaggaatagaaacctgtgggatcctctgtggaaaa
ctgacacataatgaattcaccattactcatgtggtggtgccaaagcagtctgctggccca
gactattgcgacgtggagaatgtagaagaattattcagtgttcaggatcaacatggtctc
ctcacgctgggatggattcacacacaccccacgcaaacggcattcctgtccagtgtggat
ctccacactcactgctcctatcagcttatgttgccagaggccattgccatcgtgtgttcc
ccaaagcataaagacaccggcattttcaggctcaccaacgctggcatgcttgaggtttct
acttgcaagaagaagggtttccatcctcacaccaaggaccccaagctgttcagtatatgc
agccatgtgttagtgaaagacataaagacaactgtgttggacctgaggtga

DBGET integrated database retrieval system