KEGG   Rattus norvegicus (rat): 688047Help
Entry
688047            CDS       T01003                                 

Gene name
Lyc2, Lyz2
Definition
(RefSeq) lysozyme C type 2
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     688047 (Lyc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT
Motif
Other DBs
NCBI-GeneID: 688047
NCBI-ProteinID: NP_001121966
RGD: 1593616
Ensembl: ENSRNOG00000034139
UniProt: B2RYD4
Position
7q22
AA seq 155 aa AA seqDB search
MKALLVLGFLLLSASVQAKVFKHCELARILRSSALAGYRGVSLENWMCMAQHESNFDTEA
INYNSTDQSTDYGIFQINSRYWCNDGKTPRAVNACGIPCSGAFCTLSCSHREEFETPAKE
RHSQPGHCEHPLKWKPLGNAPAECQSCCPYISAAG
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctagttctggggttcctcctgctctctgcctctgtccaggccaaggtc
tttaaacactgtgagttggccagaattctgagaagttctgcactagcaggctatcgtgga
gtcagcctggaaaactggatgtgtatggctcagcatgagagtaattttgatacagaagct
ataaactacaactctactgaccaaagcaccgactatgggatatttcagatcaatagccga
tactggtgtaatgatggcaaaaccccaagagcagtgaacgcctgtgggataccctgcagc
ggagcgttctgcacactcagctgtagtcaccgagaagagttcgaaacaccagcaaaggag
agacattctcagcctgggcactgcgagcatccacttaagtggaagcctttgggaaacgct
cctgcggaatgtcaatcctgctgtccatacatctctgctgcaggatga

DBGET integrated database retrieval system