KEGG   Rattus norvegicus (rat): 688466Help
Entry
688466            CDS       T01003                                 

Gene name
Usp21
Definition
ubiquitin specific peptidase 21 (EC:3.4.19.12)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     688466 (Usp21)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   688466 (Usp21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
13q24
AA seq 565 aa AA seqDB search
MPQASEHRLGRTREPPVNVQPRVGAKIPFPPRARSKERRNPVPGPNSMLRPLPPRPGPPD
ERLKKLDLGRGRTSGSRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLTRSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLLSIRTEPPPSH
GSFHMISARPSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILASGPVPSPPRRGGALHEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
SLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSTSRGSIKKSSVGV
DFPLQRLSLGDFASDKVGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggcttctgagcaccgcctgggccggactcgagagccacctgtcaatgtacag
ccccgagtgggagccaagataccgtttcctccccgggcccgcagcaaggagcgccgaaac
ccagttcctgggccaaactccatgttacgacctttgcctcccaggccaggtcccccagat
gaaaggctcaagaaactggatttgggtcggggtcggacctcaggctctcgtcctagaggt
ccccttcgagcagatcatggggttcccttgcctggctcaccacccccaactgtggctctg
cctctcccatcccggaccaacctaacccgatccaagtctgtgagcagtggggacttgcgt
ccaatggggattgccttgggagggcaccgtggcactggcgagctaggggctgcactgagc
cgcctggcactccggcctgagccacccactttgagacgtagtacttctctccggcgtctt
gggggtttccctggaccccctaccctgctcagcatacggacagagccccctccttcccat
ggctccttccacatgatatctgcccggccttctgagcctttctactctgatgacaagatg
gctcaccacacactgcttctgggctctggtcatgttggcctccgaaatctaggaaataca
tgcttcctgaacgccgtgttacagtgtttgagcagcacaaggcctcttcgagacttttgt
ctgcgaagggacttccggcaagaggtgcccggaggaggccgagcccaggaactcacagaa
gcctttgcagatgtgattggtgccctctggcaccctgactcctgtgaagctgtgaatcct
acccgattccgggctgtcttccagaaatacgtcccttccttctctggatacagccagcag
gatgcccaagagttcctgaagctccttatggagcggttgcacctcgaaatcaaccgacga
ggccgccgggcaccaccaattctggccagtggtccagttccctccccacctcgccgagga
ggggctctgcatgaagaacctgaactgagtgatgatgaccgagccaacttaatgtggaag
cgctacctggagcgagaagacagcaagattgtggacctgtttgtgggccagctgaaaagt
tgcctcaagtgccaggcctgtgggtatcgctccacgaccttcgaggttttttgtgacctg
tccctgcccatccccaagaaaggatttgctgggggcaaagtgtctttgcgggattgcttc
agccttttcaccaaggaggaggagctagagtcggagaatgccccagtatgtgaccgatgt
cggcagaaaacacgaagtaccaaaaagttgacagtacaaagattcccccgaatcctcgtg
ctccatctgaaccgattttccacctcccgaggctccatcaagaaaagttcagtaggtgta
gacttcccactgcagcgactaagcctaggggactttgccagcgacaaagtgggaagccct
gtctaccagctgtatgccctttgcaaccactcgggtagtgtccactatggccactacaca
gccctgtgccggtgccagactggttggcatgtctacaatgactcccgtgtctcccctgtc
agtgaaaaccaggtggcatccagtgagggctacgtgctgttctaccaattgatgcaggaa
ccacctcggtgcctgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system