KEGG   Rattus norvegicus (rat): 688634Help
Entry
688634            CDS       T01003                                 

Gene name
Kat6b, RGD1566399
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     688634 (Kat6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
15p16
AA seq 1855 aa AA seqDB search
MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDHPGRFSSVKPGTFPKPTKGPKGPPCNDLRNVDWNKLLKRAIEGLE
EPSGSSLKSIEKYLRSQSDLTGTTDHPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNTGSS
DGRGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELVSCAD
CGSSGHPSCLKFCPELTANVKALRWQCIECKTCSACRVQGKNADNMLFCDSCDRGFHMEC
CDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSD
EGSVNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKTTTSSTY
ISASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHML
ATDTEIKISIKQESMDVNVMGNKDLVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSV
IEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIY
RRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGY
FSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSY
LAYWKSVILEYLYRHHERHISIKAISRATGMCPHDIATTLQYLHMIDRRDGRFVIIRREK
LILGHMEKLKNCSRPNEVDPESLRWTPILISNAVVSEEEREAEKEAERLMEQASCWEKEE
QENLSSRVTSRQSSAKVQSKNKYLHSPERRPGPGSEDLTXCRINIEEEEEEEDDEDEEEE
EEEEESIPTSPPRLTKPQSVSIKRKRPFVVKKKRGRKRRRINSSVTTETISETTEVLNEP
FDNSDEERPMPRLEPTCEIQVEEAGRKPVLRKAFQHQPGKKRQTEEGDGKDNHFFKNAAL
CRNDVDDDAEHLEEGSRDSAEPLKCRQVWPKAAKRGLSKWRQSKERRPGLKLNLCTPPET
PMEPEGLTKVVKEQKGISEDKGSPVGEDREVTETEEALLPQDGNGREETGTPVSPHKSPG
GKADEEDLIKGEEEEEEEGTTEKDPDGAKSKEKAEAEISMEKEDAVHLDDHEEDEDEEEE
PSHNEDHDADDEDDGHMEATNVDRGDLPKEAFKDALEGQEAFLGLSIQPSHSDPEGLVNC
GGDLAVSCGSEPKELAGDAGTAPESDSELPEEQTQEQDQEKSNGADTELKDGGTATVEID
SETVQAVQSLTQENREQDDTFQDCAETQEACRSLQNYTHTDQSPQIATTLDECQQSDHSS
PVSSVHSHPGQSVRSVNSPSVPALENSYAQISPDQTAITVPPLQNMETSPMMDVPSVSDH
SQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQNSCSYGSLTSSSLTQSS
CAVTQQMSNISGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPP
MQLADIPETSNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSA
AATSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQR
NMAASNIGISHSQRLQTQIASKGPVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPART
LTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQ
YPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 5568 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttacacagagtggattcttgaagcagtgcagaaaatc
aagaagcagaagcagcggccctccgaagagaggatctgccatgcggtcagcacatcccat
gggttggacaagaaaaccgtctcggagcagctggaactcagtgttcaggatggctctgtt
ctcaaagtcaccaacaaaggccttgcttcatataaggacccggaccatcctgggcgcttt
tcatcagttaaaccaggcactttccccaagccaaccaaggggcccaaaggaccaccatgt
aatgatctacgcaatgtggattggaataaacttttaaagagagcaatcgaaggccttgag
gagccaagtggctcctccttgaagagcatcgagaagtatctgagaagccagagtgatctt
acaggcaccaccgaccacccagcctttcagcagaggttgcgactaggggccaagcgtgct
gtgaacaatgggaggttactgaaggatggaccacagtacagggtcaatactgggagctca
gatggcagaggggcaccccagtaccccagtgcttttccatcctcactcccgcctgtcagc
cttctaccccatgagaaagaccagccccgtgccgatcccattccaatatgtagcttctgt
ttggggactaaagagtcgaatcgtgaaaagaaaccagaagaactcgtgtcttgtgcagac
tgtggcagtagtggacacccatcctgtttgaaattttgtcctgaattaaccgcaaatgtg
aaggccttgaggtggcagtgcatcgagtgcaagacgtgcagcgcatgtcgagtccagggc
aaaaatgcagacaacatgcttttttgtgattcctgtgatagaggattccatatggagtgc
tgtgacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagacca
aagaaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgca
aaacccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgat
gaaggatccgtgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaa
gtctgtaccacaccttcatctggtcatgctgcgtctgggaaggactcaagcagcagattg
gctgttacagaccccacccggcctggtgccaccaccaaaaccaccacctcctccacctac
atttctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttact
aagttttttacaccatcacctgatggtcgcagatcacgaggggaaataatagacttttca
aagcactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatatgttg
gctacagatactgaaattaaaataagcatcaaacaagaaagtatggatgtaaatgtgatg
ggaaacaaggatctcgtgacggaagaggatctggacgtgtttaagcaggcccaagagctg
tcttgggagaaaatagagtgtgaaagtggagtggaagactgtggtcggtacccttcagta
atagagttcggaaaatacgaaatccaaacctggtactcctcgccttacccacaggaatat
gcaagattaccaaagctttacctgtgtgaattctgtcttaaatatatgaagagtaaaaat
attttgctaagacactcaaagaagtgtggatggtttcatcctccagcaaatgaaatttac
cgaaggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttattgccaa
aacctttgcttgttagccaagctcttcctggaccacaaaacattgtattatgatgtcgag
ccattccttttttatgtccttacaaaaaacgatgaaaaaggctgtcatctggttggatac
ttctctaaggaaaagctctgccagcagaagtataacgtgtcctgcataatgatcatgccc
cagcaccaaaggcaaggatttggacgctttctcattgatttcagctatttgctttctcga
agagaaggccaagcggggtctcctgaaaagccgctgtctgacctaggccggctgtcctac
ctggcctactggaaaagcgtcatcttggagtacctctaccgccaccacgagaggcacatc
agcatcaaagccatcagcagagccacaggcatgtgcccacatgacattgccaccactctg
cagtacctgcacatgatcgacaggagagacggcaggtttgtcatcattagaagggaaaag
ttgatattgggccacatggaaaagctgaagaactgttcccgacccaatgaagttgacccg
gagagtctccgatggaccccaattttaatttctaatgccgtagtttctgaagaagagcgg
gaggctgaaaaggaggctgaacgactgatggaacaagccagctgctgggagaaggaggag
caagagaacctgtcatctagagttaccagcaggcagtcatctgcaaaagtacaatcaaaa
aacaagtacctgcactctcccgagaggcggccagggccggggagcgaggacttgacatga
tgccgtattaacatcgaggaggaggaggaggaggaagacgatgaggatgaggaggaagag
gaggaggaagaagagagcattccgacatctcccccacggttgactaagccacagtcggtc
tccatcaagagaaagaggccttttgtagtaaagaagaaaaggggtcgtaaacgcaggagg
atcaacagcagtgtgacaaccgagaccatctccgagactacagaagtgctaaatgaaccc
ttcgacaactcagatgaagagcggcccatgccaaggctggagcctacctgtgagatccaa
gtggaggaggcgggcaggaagccagttctgagaaaagccttccagcatcagccagggaag
aagaggcagacagaggaaggggacggaaaagacaatcatttcttcaagaacgctgccctt
tgtagaaacgatgtggatgatgacgcagaacacttggaagaaggcagcagagacagtgca
gagcctctgaagtgcagacaagtgtggccgaaagcagcgaagcgaggcctctccaagtgg
aggcaaagcaaggagaggaggccggggctcaagctgaatctgtgcaccccacccgagaca
cccatggagccggagggcctgacgaaggtggtcaaagagcagaagggaatttcagaggac
aagggcagccccgtgggcgaggatcgggaggtgacagagactgaggaagccctgctgcct
caggatgggaacggaagggaagagacaggcacacctgtgagtccacataaatcaccaggt
ggaaaggcagacgaggaggacctcatcaaaggggaggaggaggaggaggaagagggaact
acagagaaagacccagatggtgctaaaagtaaagagaaagctgaagcagaaatctccatg
gaaaaggaagacgcggtgcatttggatgaccatgaggaggacgaggacgaggaggaagag
ccgtctcacaatgaggaccatgatgcggatgatgaagacgacggtcacatggaggctacc
aacgtggacaggggagacctcccaaaagaagccttcaaggacgcactagagggtcaggag
gcttttttaggccttagcattcagcctagtcactctgaccctgagggcctggtgaactgc
ggtggtgatctggcagtgtcgtgtggcagtgagccgaaggagcttgctggggacgctggc
accgcacctgagtccgactcggagctcccggaagaacagacacaggagcaggaccaagag
aagagcaatggtgcggatacagagctcaaggacggaggcacagccaccgtggaaatcgac
tctgagaccgtccaggctgttcagtctttgacccaagaaaacagggagcaggatgacacc
tttcaagattgtgctgagactcaagaggcctgtagaagcctgcagaactatacacacaca
gaccaaagtcctcaaattgccaccacgctggacgagtgccaacagtcagaccacagtagc
ccggtttcatctgtccattcccatcctggccagtcagttcgttctgtcaatagccccagt
gtccctgccctagagaatagctatgcccaaatcagccctgatcagactgccatcacagtg
ccacctctgcagaacatggagaccagtccaatgatggacgtcccgtcagtgtccgatcac
tcacagcaagttgttgacagtgggttcagtgacctgggcagtattgagagcacaacagag
aactatgagaaccccagcagctacgactcgaccatgggaggcagcatctgtggaaacagc
tcctcccagaacagttgctcctacggcagcctcacctctagcagtctgacacagagcagc
tgtgctgtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcagacc
agcatcagctcccctccaacctgcagcgtcaagtctccccaaggctgtgtggtggagcgg
ccgcccagcagcagccagcagctggctcagtgcagcatggccgccaacttcaccccaccc
atgcagctggccgacatccccgagaccagcaacgccaacatcggcctatacgagcgaatg
ggccaaagtgattttggggctgggcactacccacagccgtccgccaccttcagccttgcc
aagctgcagcagctaactaatacccttattgatcattcattgccttacagccactccgct
gccgccacctcctatgcaaatagtgcctctttgtccacaccattaagtaacacagggctt
gttcagctttcacagtctccacactccgtccctggaggaccccaagcacaagctaccatg
accccaccccctaacctgactcctcctcccatgaacctgccaccacctctcctgcagcgg
aacatggctgcatcaaatattggcatctcccacagccaaagactgcaaactcagatcgcc
agcaagggccccgtctccatgagaaccaagtcggcatctctgtcaccagccgctgccacc
catcagtcacaaatctatgggcgttcccagactgtggccatgcagggtcctgcacggact
ttaacgatgcagagaggcatgaacatgagtgtgaacctgatgccagcgccagcctacaac
gtcaactctgtgaacatgaacatgaacactctgaatgccatgaatgggtacagcatgtcc
cagccgatgatgaacagtggttaccacagcaaccatggctacatgaatcagacaccccag
taccctatgcagatgcagatgggcatgatgggcacccagccatacgcccagcagccaatg
cagaccccaccccacagtaacatgatgtacacggcccccggacaccacggctacatgaac
acgggcatgtccaaacagtctctcaacgggtcctacatgagaaggtag

DBGET integrated database retrieval system