KEGG   Rattus norvegicus (rat): 688634Help
Entry
688634            CDS       T01003                                 

Gene name
RGD1566399
Definition
similar to MYST histone acetyltransferase monocytic leukemia 4
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     688634 (RGD1566399)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
15p16
AA seq 1746 aa AA seqDB search
MVKLANPLYTEWILEAVQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDHPGRFSSVKPGTFPKPTKGPKGPPCNDLRNVDWNKLLKRAIEGLE
EPSGSSLKSIEKYLRSQSDLTGTTDHPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNTGSS
DGRGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELVSCAD
CGSSGHPSCLKFCPELTANVKALRWQCIECKTCSACRVQGKNADNMLFCDSCDRGFHMEC
CDPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSD
EGSVNAFTGRGSPDTEIKISIKQESMDVNVMGNKDLVTEEDLDVFKQAQELSWEKIECES
GVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKC
GWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTK
NDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPE
KPLSDLGRLSYLAYWKSVILEYLYRHHERHISIKAISRATGMCPHDIATTLQYLHMIDRR
DGRFVIIRREKLILGHMEKLKNCSRPNEVDPESLRWTPILISNAVVSEEEREAEKEAERL
MEQASCWEKEEQENLSSRVTSRQSSAKVQSKNKYLHSPERRPGPGSEDLTXCRINIEEEE
EEEDDEDEEEEEEEEESIPTSPPRLTKPQSVSIKRKRPFVVKKKRGRKRRRINSSVTTET
ISETTEVLNEPFDNSDEERPMPRLEPTCEIQVEEAGRKPVLRKAFQHQPGKKRQTEEGDG
KDNHFFKNAALCRNDVDDDAEHLEEGSRDSAEPLKCRQVWPKAAKRGLSKWRQSKERRPG
LKLNLCTPPETPMEPEGLTKVVKEQKGISEDKGSPVGEDREVTETEEALLPQDGNGREET
GTPVSPHKSPGGKADEEDLIKGEEEEEEEGTTEKDPDGAKSKEKAEAEISMEKEDAVHLD
DHEEDEDEEEEPSHNEDHDADDEDDGHMEATNVDRGDLPKEAFKDALEGQEAFLGLSIQP
SHSDPEGLVNCGGDLAVSCGSEPKELAGDAGTAPESDSELPEEQTQEQDQEKSNGADTEL
KDGGTATVEIDSETVQAVQSLTQENREQDDTFQDCAETQEACRSLQNYTHTDQSPQIATT
LDECQQSDHSSPVSSVHSHPGQSVRSVNSPSVPALENSYAQISPDQTAITVPPLQNMETS
PMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQNSCSYG
SLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSISSPPTCSVKSPQGCVVERPPSSSQQLA
QCSMAANFTPPMQLADIPETSNANIGLYERMGQSDFGAGHYPQPSATFSLAKLQQLTNTL
IDHSLPYSHSAAATSYANSASLSTPLSNTGLVQLSQSPHSVPGGPQAQATMTPPPNLTPP
PMNLPPPLLQRNMAASNIGISHSQRLQTQIASKGPVSMRTKSASLSPAAATHQSQIYGRS
QTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYH
SNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQTPPHSNMMYTAPGHHGYMNTGMSKQSLN
GSYMRR
NT seq 5241 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttacacagagtggattcttgaagcagtgcagaaaatc
aagaagcagaagcagcggccctccgaagagaggatctgccatgcggtcagcacatcccat
gggttggacaagaaaaccgtctcggagcagctggaactcagtgttcaggatggctctgtt
ctcaaagtcaccaacaaaggccttgcttcatataaggacccggaccatcctgggcgcttt
tcatcagttaaaccaggcactttccccaagccaaccaaggggcccaaaggaccaccatgt
aatgatctacgcaatgtggattggaataaacttttaaagagagcaatcgaaggccttgag
gagccaagtggctcctccttgaagagcatcgagaagtatctgagaagccagagtgatctt
acaggcaccaccgaccacccagcctttcagcagaggttgcgactaggggccaagcgtgct
gtgaacaatgggaggttactgaaggatggaccacagtacagggtcaatactgggagctca
gatggcagaggggcaccccagtaccccagtgcttttccatcctcactcccgcctgtcagc
cttctaccccatgagaaagaccagccccgtgccgatcccattccaatatgtagcttctgt
ttggggactaaagagtcgaatcgtgaaaagaaaccagaagaactcgtgtcttgtgcagac
tgtggcagtagtggacacccatcctgtttgaaattttgtcctgaattaaccgcaaatgtg
aaggccttgaggtggcagtgcatcgagtgcaagacgtgcagcgcatgtcgagtccagggc
aaaaatgcagacaacatgcttttttgtgattcctgtgatagaggattccatatggagtgc
tgtgacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagacca
aagaaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgca
aaacccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgat
gaaggatccgtgaatgcattcacaggaagggggtcacctgatactgaaattaaaataagc
atcaaacaagaaagtatggatgtaaatgtgatgggaaacaaggatctcgtgacggaagag
gatctggacgtgtttaagcaggcccaagagctgtcttgggagaaaatagagtgtgaaagt
ggagtggaagactgtggtcggtacccttcagtaatagagttcggaaaatacgaaatccaa
acctggtactcctcgccttacccacaggaatatgcaagattaccaaagctttacctgtgt
gaattctgtcttaaatatatgaagagtaaaaatattttgctaagacactcaaagaagtgt
ggatggtttcatcctccagcaaatgaaatttaccgaaggaaagacctttcagtatttgag
gttgatgggaatatgagcaaaatttattgccaaaacctttgcttgttagccaagctcttc
ctggaccacaaaacattgtattatgatgtcgagccattccttttttatgtccttacaaaa
aacgatgaaaaaggctgtcatctggttggatacttctctaaggaaaagctctgccagcag
aagtataacgtgtcctgcataatgatcatgccccagcaccaaaggcaaggatttggacgc
tttctcattgatttcagctatttgctttctcgaagagaaggccaagcggggtctcctgaa
aagccgctgtctgacctaggccggctgtcctacctggcctactggaaaagcgtcatcttg
gagtacctctaccgccaccacgagaggcacatcagcatcaaagccatcagcagagccaca
ggcatgtgcccacatgacattgccaccactctgcagtacctgcacatgatcgacaggaga
gacggcaggtttgtcatcattagaagggaaaagttgatattgggccacatggaaaagctg
aagaactgttcccgacccaatgaagttgacccggagagtctccgatggaccccaatttta
atttctaatgccgtagtttctgaagaagagcgggaggctgaaaaggaggctgaacgactg
atggaacaagccagctgctgggagaaggaggagcaagagaacctgtcatctagagttacc
agcaggcagtcatctgcaaaagtacaatcaaaaaacaagtacctgcactctcccgagagg
cggccagggccggggagcgaggacttgacatgatgccgtattaacatcgaggaggaggag
gaggaggaagacgatgaggatgaggaggaagaggaggaggaagaagagagcattccgaca
tctcccccacggttgactaagccacagtcggtctccatcaagagaaagaggccttttgta
gtaaagaagaaaaggggtcgtaaacgcaggaggatcaacagcagtgtgacaaccgagacc
atctccgagactacagaagtgctaaatgaacccttcgacaactcagatgaagagcggccc
atgccaaggctggagcctacctgtgagatccaagtggaggaggcgggcaggaagccagtt
ctgagaaaagccttccagcatcagccagggaagaagaggcagacagaggaaggggacgga
aaagacaatcatttcttcaagaacgctgccctttgtagaaacgatgtggatgatgacgca
gaacacttggaagaaggcagcagagacagtgcagagcctctgaagtgcagacaagtgtgg
ccgaaagcagcgaagcgaggcctctccaagtggaggcaaagcaaggagaggaggccgggg
ctcaagctgaatctgtgcaccccacccgagacacccatggagccggagggcctgacgaag
gtggtcaaagagcagaagggaatttcagaggacaagggcagccccgtgggcgaggatcgg
gaggtgacagagactgaggaagccctgctgcctcaggatgggaacggaagggaagagaca
ggcacacctgtgagtccacataaatcaccaggtggaaaggcagacgaggaggacctcatc
aaaggggaggaggaggaggaggaagagggaactacagagaaagacccagatggtgctaaa
agtaaagagaaagctgaagcagaaatctccatggaaaaggaagacgcggtgcatttggat
gaccatgaggaggacgaggacgaggaggaagagccgtctcacaatgaggaccatgatgcg
gatgatgaagacgacggtcacatggaggctaccaacgtggacaggggagacctcccaaaa
gaagccttcaaggacgcactagagggtcaggaggcttttttaggccttagcattcagcct
agtcactctgaccctgagggcctggtgaactgcggtggtgatctggcagtgtcgtgtggc
agtgagccgaaggagcttgctggggacgctggcaccgcacctgagtccgactcggagctc
ccggaagaacagacacaggagcaggaccaagagaagagcaatggtgcggatacagagctc
aaggacggaggcacagccaccgtggaaatcgactctgagaccgtccaggctgttcagtct
ttgacccaagaaaacagggagcaggatgacacctttcaagattgtgctgagactcaagag
gcctgtagaagcctgcagaactatacacacacagaccaaagtcctcaaattgccaccacg
ctggacgagtgccaacagtcagaccacagtagcccggtttcatctgtccattcccatcct
ggccagtcagttcgttctgtcaatagccccagtgtccctgccctagagaatagctatgcc
caaatcagccctgatcagactgccatcacagtgccacctctgcagaacatggagaccagt
ccaatgatggacgtcccgtcagtgtccgatcactcacagcaagttgttgacagtgggttc
agtgacctgggcagtattgagagcacaacagagaactatgagaaccccagcagctacgac
tcgaccatgggaggcagcatctgtggaaacagctcctcccagaacagttgctcctacggc
agcctcacctctagcagtctgacacagagcagctgtgctgtcacccagcagatgtccaac
atcagcgggagctgcagcatgctgcagcagaccagcatcagctcccctccaacctgcagc
gtcaagtctccccaaggctgtgtggtggagcggccgcccagcagcagccagcagctggct
cagtgcagcatggccgccaacttcaccccacccatgcagctggccgacatccccgagacc
agcaacgccaacatcggcctatacgagcgaatgggccaaagtgattttggggctgggcac
tacccacagccgtccgccaccttcagccttgccaagctgcagcagctaactaataccctt
attgatcattcattgccttacagccactccgctgccgccacctcctatgcaaatagtgcc
tctttgtccacaccattaagtaacacagggcttgttcagctttcacagtctccacactcc
gtccctggaggaccccaagcacaagctaccatgaccccaccccctaacctgactcctcct
cccatgaacctgccaccacctctcctgcagcggaacatggctgcatcaaatattggcatc
tcccacagccaaagactgcaaactcagatcgccagcaagggccccgtctccatgagaacc
aagtcggcatctctgtcaccagccgctgccacccatcagtcacaaatctatgggcgttcc
cagactgtggccatgcagggtcctgcacggactttaacgatgcagagaggcatgaacatg
agtgtgaacctgatgccagcgccagcctacaacgtcaactctgtgaacatgaacatgaac
actctgaatgccatgaatgggtacagcatgtcccagccgatgatgaacagtggttaccac
agcaaccatggctacatgaatcagacaccccagtaccctatgcagatgcagatgggcatg
atgggcacccagccatacgcccagcagccaatgcagaccccaccccacagtaacatgatg
tacacggcccccggacaccacggctacatgaacacgggcatgtccaaacagtctctcaac
gggtcctacatgagaaggtag

  All links  
No link information was found.   
DBGET integrated database retrieval system