KEGG   Rattus norvegicus (rat): 688673Help
Entry
688673            CDS       T01003                                 

Gene name
Pomt2
Definition
protein-O-mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    688673 (Pomt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     688673 (Pomt2)
Glycosyltransferases [BR:rno01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   688673 (Pomt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q31
AA seq 820 aa AA seqDB search
MFYASGRLLAAREATTLYAPPRARGPALRGKRRELQIPWHLETPSYDSLTGQRTRPGVPP
ARRVILRKGRMPPAIGGGLAGSELRPRRGRSVQQAARAVSRDVVPEAATRKLKRPAWSSR
RFQAAGWWATLAVVTLLSFATRFHRLDQPAHICWDETHFGKMGSYYINRTFFFDVHPPLG
KMLIGLAGYLSGYDGTFLFQKPGDRYEHHSYMGMRGFCAFLGSWLIPFAYLTVLDLSKSF
PAALLTAALLTCDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSFANRPFSAPWWFWLS
LTGISLAGALGVKFVGLFIIVQVGLNTISDLWHLFGDLSLSLVTVGKHLTARILCLIVLP
LVLYVTIFAVHVMVLNKSGPGDGFFSSAFQARLSGNSLHNASIPEHLAYGSVITVKNLRM
AIGYLHSHRHLYPEGIGARQQQVTTYLHKDYNNLWIIKKYNTNTDPLDPSFPVEFVRHGD
IIRLEHKETTRNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVL
RSRIRFIHLVTGCVLGSSGKILPKWGWEQLEVTCNPYLKETSNSIWNIEEHINPKLPNIS
LDVLQPSFPEILLESHMVMIRGNNGLKPKDNEFTSKPWHWPINYQGLRFSGANDTDFRVY
LLGNPVVWWLNLVSLVLYLLTGSTIAIAMQRGIQLPAELQGLTKLLLRGGGQLLLGWTLH
YFPFFLMGRVLYFHHYFPAMLFSSMLTGLLWDTLLRFCAWALAPSPLGRRIHMVGILSLL
LATAYSFYLFHPLAYGMVGPLAQEPESPMAGLRWLESWDF
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgttttacgcctcaggccgcctcttagccgcccgggaggccaccacactctacgcccct
cccagagcccggggcccggcactccgcggcaaacggagggaactacaaatcccatggcac
ctcgagacgccctcttacgactccttgacggggcagcggacaagacccggcgtgcctccg
gcccggagggtgatccttagaaaggggaggatgccgccggccataggcggtggcctagcg
ggctcggagctgcgtccccgtaggggccgcagtgtgcagcaggctgccagagccgtgagc
cgagacgtggtccccgaggctgcaacgcggaaacttaaacggcctgcttggagctcgcgg
cgcttccaggcggcaggctggtgggccacgctggctgtggtgacgctgctgtcctttgcc
acccgctttcacaggctggaccagccggcacacatctgttgggatgagactcactttgga
aaaatgggaagttactacattaaccgcacctttttcttcgatgtgcacccaccactggga
aagatgctgattggccttgctggctacctgagtggatatgatggtacctttttgttccag
aagcctggggaccgatacgagcaccacagctacatggggatgagagggttctgtgctttc
ctgggttcctggctgatcccctttgcctacctcactgtactggatctgtccaagtccttc
ccagcagcactgctcaccgctgccctgctcacctgtgacacgggatgcctcactctgtcc
cagtacatcctccttgaccccatcctgatgttcttcatcatggctgccatgctgagcatg
gtcaagtacaactccttcgctaacaggcctttctctgccccctggtggttctggctcagc
ctgactggcattagtcttgctggcgctttaggggtcaaatttgttggcctctttatcatt
gtgcaagtggggttgaacaccatctcagacctctggcacctgtttggagacctcagtctt
tcactggtgactgtggggaaacacctgactgctcgcatcctgtgcctcatagtgctgccc
ttggtgctctatgtgaccatttttgctgttcatgtcatggtgctgaataaaagtggtcct
ggtgatggcttcttcagttctgcctttcaagcccgactttcagggaacagccttcacaat
gcttctatccctgaacacttggcgtatggctctgtaatcactgtgaagaacctccggatg
gccatcggctaccttcactcccacaggcacctctaccctgagggcattggtgcacgccag
cagcaggttaccacctatttgcataaggactacaacaacctgtggattatcaagaaatac
aataccaacacagatcctctagacccttccttcccagtggagtttgtcagacatggggac
atcatacgactagaacacaaagaaactactcggaacctgcacagtcactatcatgaggct
cccctgacccggaagcactatcaggtcactggctatggcataaatgggacaggggactca
aatgacttctggaggattgaagttgtaaatagaaaatttgggaaccggatcaaggtactg
agaagtcgaattcgcttcatccatttggttacaggttgtgtcctgggatcttcaggaaag
attctgcctaagtggggctgggagcagttggaagttacttgtaatccgtacttaaaagaa
accagtaactccatttggaacatagaagaacatatcaatcccaaactgccaaacatcagc
ctggatgtgctgcaacccagttttcctgagatcttgctggagtcccacatggtcatgatc
cggggaaacaatggcctcaaacctaaggacaatgagtttacatccaaaccctggcactgg
cctatcaattatcagggcctgcgcttctcaggggccaatgacacggacttccgagtctat
ctgctcggcaaccctgtggtctggtggctcaacctggtgagcctcgtcctctacctcctc
acgggcagcaccattgccatcgccatgcagagagggatacagctgcctgcagagttgcaa
gggctgaccaagctgctgctgcgaggaggtggccagctgctcctgggatggacgctccat
tacttccctttcttcctgatgggccgcgtcctctacttccaccactacttcccagccatg
ctcttttccagcatgttgacaggtctcctgtgggatactcttctgcggttctgtgcctgg
gccttggccccttctcccctgggtaggagaatacatatggtgggaatcctgagcctgctt
ctggcaactgcctacagcttctacctctttcaccctctggcttatgggatggttggtccc
ctagcccaggaacctgagagtccaatggcaggactgaggtggctggaatcatgggacttt
tga

DBGET integrated database retrieval system