KEGG   Rattus norvegicus (rat): 689730Help
Entry
689730            CDS       T01003                                 

Definition
similar to ubiquitin specific peptidase 17 (homolog)
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1q33
AA seq 832 aa AA seqDB search
MVTAHSFTEEDPAMSPPATPELHQDEAQVLEELSAKGKPSLSLQRIQSPGSGLQNIGNSC
YLNAVLQCLTHTPPLADYMLSQEHSQRCCYPEGCKMCAMEAHVTQSLLHSHSGGVMKPSE
ILTSTFHKHRQEDSHEFLMFTLNAMHESCLRGCKQSETSSKDSSLIYDIFGGQMRSQIKC
HHCQGTLDSYDPFLNLFLDICSAQSVKQALNINQYGIHLEEYTDPHNNIHLRNGVATYPV
SDVRSLTSLQSRLLDLFEGSGFDTEGERWAVSTCGISCSSNPNEKSEPNAWDVQVLTYTK
ETDSIFWRERLPSADLEDSSRLFERDHRKMVTAPSFTEDPAMSPPATPELHQDEARVLEE
LSAKGKPSLSLQRIQSPGSGLQNIGNSCYLNAVLQCLTHTPPLADYMLSQEHSQRCCYPE
GCKMCAMEAHVTQSLLHSHSGGVMKPSEILTSTFHKHRQEDAHEFLMFTLNAMHESCLRG
CKQSETSSKDSSLIYDIFGGQMRSQIKCHHCQGTLDSYDPFLNLFLDICSAQSVKQALED
LVKLEELQGDNAYYCGRCREKMPASKTTKVQTASKVLLLVLNRSYDFGGDKLNRVVSYPE
YLDLQPYLSQPTAGPLPYALYAVLVHDGVTCSSGHYFCYVKASHGKWYKMDDSKVTRCDV
SSVLSEPAYLLFYVQQTDLEKVNVDVSVGRVHGVLHPESQQKKTRKKKHKRSSCTEAVYM
PRENRENTATKETSLGEGKVLQEQNHQKAGQNLKTTKVNLSANGTVIHQPRYTANWGRNA
PDKDDQPGHSGDRLLTTQGSMNTGQLCGHGGSQRSKKRKNKNKQGQRPLLVC
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgctcactccttcacagaagaagatccagccatgtcaccacctgctacccca
gagctccatcaagatgaagcacaggtgctagaggagctgtctgccaaggggaagcccagt
ctgagtttgcagaggatccaaagcccagggtcagggctccagaacataggcaacagctgc
tacctgaatgcagtcctgcagtgcttgacacacacaccacctcttgccgactatatgctg
tcccaggagcattctcagaggtgttgttacccagaaggctgtaagatgtgtgctatggaa
gctcatgtgacccagagtctcctccactcccactcaggaggtgtcatgaaaccctccgag
atattgacctctaccttccacaagcacaggcaggaagattcccatgaatttctcatgttc
accttgaatgccatgcatgaatcctgccttcgagggtgcaagcaatcagaaacctcctct
aaggacagctccctgatctatgacatatttggaggccagatgagatctcagatcaagtgt
caccactgccagggcaccttagattcctacgatcccttcctgaacctcttcctggatatc
tgctctgctcagagtgtgaagcaagccttgaatataaatcagtatggtattcacttggaa
gagtatactgaccctcataataacattcatctcagaaatggagttgccacctaccctgtc
tctgatgtgaggtcattgacttcactgcaatcccggttgctagacttgtttgaaggttct
gggtttgatactgaaggagaaaggtgggcagtcagcacctgtggcatcagctgttcatca
aaccctaatgaaaagtcagagcctaatgcttgggatgtgcaagtactgacgtacactaaa
gaaacagattcgattttctggagggaaagacttccttctgctgacttagaagattccagc
aggttattcgaacgggatcatagaaaaatggtgactgctccctccttcacagaagatcca
gccatgtcaccacctgctaccccagagctccatcaagatgaagcacgggtgctagaggag
ctgtctgccaaggggaagcccagtctgagtttgcagaggatccaaagcccagggtcaggg
ctccagaacataggcaacagctgctacctgaatgcagtcctgcagtgcttgacacacaca
ccacctcttgccgactatatgctgtcccaggagcattctcagaggtgttgttacccagaa
ggctgtaagatgtgtgctatggaagctcatgtgacccagagtctcctccactcccactca
ggaggtgtcatgaaaccctccgagatattgacctctaccttccacaagcacaggcaggaa
gatgcccatgaatttctcatgttcaccttgaatgccatgcatgaatcctgccttcgaggg
tgcaagcaatcagaaacctcctctaaggacagctccctgatctatgacatatttggaggc
cagatgagatctcagatcaagtgtcaccactgccagggcaccttagattcctacgatccc
ttcctgaacctcttcctggatatctgctctgctcagagtgtgaagcaagccttggaggac
ttagtgaagctagaagagttgcagggggacaacgcctactactgtggtaggtgtagagag
aagatgccagcttctaagaccacgaaggttcagactgcctcaaaggttctcctgctagtg
ttaaaccgctcctacgatttcgggggtgacaagttgaacagggtagtaagctacccagag
taccttgacctgcagccatacctgtcacagccaactgcaggacccctgccttatgctctc
tatgccgtcctggtccatgatggggtgacttgttccagtggacattacttctgttatgtc
aaagccagccatgggaagtggtataagatggatgattctaaggtcaccaggtgcgatgtg
tcctctgtcctgagcgagcctgcctatctgctcttctatgtccagcagactgaccttgag
aaggtcaatgttgatgtgtctgtgggcagagtacatggggttcttcaccctgaatcccag
cagaagaaaacgcggaagaaaaagcacaagagaagctcttgcacagaagctgtatacatg
ccccgagaaaacagggaaaatacagccaccaaagaaacctccttaggggaggggaaagtg
cttcaggaacagaaccaccagaaagctgggcagaacctcaagactaccaaagtcaatttg
tcagccaacggaactgtgattcatcagcccagatataccgcaaactggggcaggaatgct
ccagacaaggacgatcaaccagggcacagtggtgacagactcctcaccactcagggctcc
atgaacactgggcagctctgtggtcatggagggagccaaagatctaagaagaggaagaac
aagaacaagcaagggcagaggcctctgcttgtttgctag

DBGET integrated database retrieval system