KEGG   Rattus norvegicus (rat): 689730Help
Entry
689730            CDS       T01003                                 

Definition
(RefSeq) similar to ubiquitin specific peptidase 17 (homolog)
  KO
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     689730
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   689730
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    689730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
1
AA seq 513 aa AA seqDB search
MSSTKAVGPKVVLCSCPVEDPAMSPPATPELHQDEARVLEELSAKGKPSLSLQRIQSPGS
GLQNIGNSCYLNAVLQCLTHTPPLADYMLSQEHSQRCCYPEGCKMCAMEAHVTQSLLHSH
SGGVMKPSEILTSTFHKHRQEDAHEFLMFTLNAMHESCLRGCKQSETSSKDSSLIYDIFG
GQMRSQIKCHHCQGTLDSYDPFLNLFLDICSAQSVKQALEDLVKLEELQGDNAYYCGRCR
EKMPASKTTKVQTASKVLLLVLNRSYDFGGDKLNRVVSYPEYLDLQPYLSQPTAGPLPYA
LYAVLVHDGVTCSSGHYFCYVKASHGKWYKMDDSKVTRCDVSSVLSEPAYLLFYVQQTDL
EKVNVDVSVGRVHGVLHPESQQKKTRKKKHKRSSCTEAVHMPRENRENTATKETSLGEGK
VLQEQNHQKAGQNLKTTKVNLSANGTVIHQPRYTANWGRNAPDKDDQPGHSGDRLLTTQG
SMNTGQLCGHGGSQRSKKRKNKNKQGQRPLLVC
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccaccaaagctgttggccctaaagtcgttttgtgttcttgtcctgtagaagat
ccagccatgtcaccacctgctaccccagagctccatcaagatgaagcacgggtgctagag
gagctgtctgccaaggggaagcccagtctgagtttgcagaggatccaaagcccagggtca
gggctccagaacataggcaacagctgctacctgaatgcagtcctgcagtgcttgacacac
acaccacctcttgccgactatatgctgtcccaggagcattctcagaggtgttgttaccca
gaaggctgtaagatgtgtgctatggaagctcatgtgacccagagtctcctccactcccac
tcaggaggtgtcatgaaaccctccgagatattgacctctaccttccacaagcacaggcag
gaagatgcccatgaatttctcatgttcaccttgaatgccatgcatgaatcctgccttcga
gggtgcaagcaatcagaaacctcctctaaggacagctccctgatctatgacatatttgga
ggccagatgagatctcagatcaagtgtcaccactgccagggcaccttagattcctacgat
cccttcctgaacctcttcctggatatctgctctgctcagagtgtgaagcaagccttggag
gacttagtgaagctagaagagttgcagggggacaacgcctactactgtggtaggtgtaga
gagaagatgccagcttctaagaccacgaaggttcagactgcctcaaaggttctcctgcta
gtgttaaaccgctcctacgatttcgggggtgacaagttgaacagggtagtaagctaccca
gagtaccttgacctgcagccatacctgtcacagccaactgcaggacccctgccttatgct
ctctatgccgtcctggtccatgatggggtgacttgttccagtggacattacttctgttat
gtcaaagccagccatgggaagtggtataagatggatgattctaaggtcaccaggtgcgat
gtgtcctctgtcctgagcgagcctgcctatctgctcttctatgtccagcagactgacctt
gagaaggtcaatgttgatgtgtctgtgggcagagtacatggggttcttcaccctgaatcc
cagcagaagaaaacgcggaagaaaaagcacaagagaagctcttgcacagaagctgtacac
atgccccgagaaaacagggaaaatacagccaccaaagaaacctccttaggggaggggaaa
gtgcttcaggaacagaaccaccagaaagctgggcagaacctcaagactaccaaagtcaat
ttgtcagccaacggaactgtgattcatcagcccagatataccgcaaactggggcaggaat
gctccagacaaggacgatcaaccagggcacagtggtgacagactcctcaccactcagggc
tccatgaacactgggcaactctgtggtcatggagggagccaaagatctaagaagaggaag
aacaagaacaagcaagggcagaggcctctgcttgtttgctag

DBGET integrated database retrieval system