KEGG   Rattus norvegicus (rat): 689754Help
Entry
689754            CDS       T01003                                 

Gene name
Ces3a, Ces3-ps1
Definition
carboxylesterase 3a
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     689754 (Ces3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
19q11
AA seq 598 aa AA seqDB search
MTNMGTTVRAGSSVLLWVIYLFLVFPTTVTGPKVPQPEMDTPXGHVQGQQVGVKNTEHVV
NVFLSIPFAQAPLGXLQFSVPLPXQPWEGVRVASTNLPMCLQDVERMNSSRFTPNEKHLI
FPISEDCLILSXEITAGTKRLVMVWIHGESLEVGSATAQDGSALAAYGGVVVVTVQYHLR
IFGFLSTGDKHMPSNRGFLDVVAALCWIQGNIAPFGGEPNCVTVFGNSAGGSIVSSLVSY
YREVAVMVISERASMVPDLLAPLPSNICPLCSPLSPMFAGLSHRAISQSGVITTRMMKEM
NTXPXARNFANSVACSSGSPAELVQCLLQKEEKDLIQKNVNVSYIINDSFPQRPEKILTD
RQLPTVPYLLGVTNHEFGWLILRIWNILDKLEHLSPEDLLDISRPFLALMEVPPEIMPTV
IDQYLDNGSDESATKYAFQELLGDITLIIPILNFSKYLQDAGCPVLLYEFQNTPNSFAKF
KSAWVKAEHASENSFVFGGPFLIEESSLLAFPEATEEEKQLSLTMIAQWSQSHTGNPNGK
ELPPWPQLNQLEQYLEVGLEPQTGVKLKKGRLQFWTETLPRKIQEWHRQQRRRNLEEL
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatatggggacaacggtacgagctgggtccagtgtcctactctgggtgatctat
ctgttcctggtatttcctaccacagtcactggacccaaagtccctcagcctgaaatggat
acccctntgggtcatgttcaaggccagcaggtaggtgtgaagaatacagagcacgtggta
aatgtcttcctgagcattccctttgctcaggcaccactaggantgcttcagttctcggtt
ccactcccancacagccctgggaaggtgtgagagttgccagcaccaatctcccaatgtgt
ctgcaggatgtagagagaatgaacagcagcagattcacccccaacgaaaagcacctaatc
ttccctatttctgaggactgcctgatcctcagcnntgagatcactgcagggaccaaaagg
ctggtcatggtatggatccatggggaatctctggaagttggctccgccaccgctcaggac
ggatcagccctggctgcctatgggggtgtggtagtcgtcactgtccagtatcaccttagg
atctttggcttcctcagcactggggataagcacatgccaagcaacagggggttcctggat
gtggtggctgctctgtgctggatccaggggaacatagccccctttgggggtgaacccaac
tgtgtcactgtcttcggtaattctgctggtggctctatcgtctcatccctggtgagttac
tacagagaagtggcagtcatggttatatctgagagggcatctatggtcccagacctccta
gctcctctgccttctaacatctgtcctctctgctctcccctgtctccaatgtttgctggg
ctctcccacagagccatatcccagagtggggttatcaccaccaggatgatgaaagagatg
aacacatagccttaagctcggaactttgccaattctgtggcctgtagttctggatcccca
gctgagctggtacagtgtttgctgcagaaggaagaaaaggatcttatacagaaaaatgtg
aacgtttcctatatcattaatgactccttcccacaaaggccagagaagatcctcacagat
cggcaactccccactgtgccctacctcctgggagtcaccaaccatgagtttggctggctc
atactcaggatctggaatatcctggataagttggaacatttgagcccggaggacctatta
gatatttcaaggcctttcttggcccttatggaagtgccccctgagatcatgcccactgtc
atagatcaatacctagacaatggctcagatgaatcagctacaaagtatgccttccaggaa
ttgctgggtgatatcacactcatcattcctatcttgaacttctcaaaataccttcaagat
gctgggtgccctgttctcttgtatgagttccagaatacacccaattcttttgcgaagttc
aagtcagcctgggtgaaggctgaacatgcatctgagaattcctttgtttttggaggtcct
ttcctcattgaagagagctccctcctggccttcccagaggccacagaggaagagaagcag
ctgagcctaaccatgatagcccagtggagccagtcgcacacagggaaccccaatggcaag
gagctacctccttggccccaattaaaccagttagaacaatacttggaggttggtctagaa
ccacagactggggtgaagctaaagaagggtcggctacagttctggacagagacactgccc
agaaaaattcaagaatggcaccggcagcagaggagaaggaatctggaggagctctga

DBGET integrated database retrieval system