KEGG   Rattus norvegicus (rat): 689883Help
Entry
689883            CDS       T01003                                 

Gene name
Setdb1
Definition
(RefSeq) SET domain, bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    689883 (Setdb1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    689883 (Setdb1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     689883 (Setdb1)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     689883 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    689883 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
2q34
AA seq 1302 aa AA seqDB search
MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQFIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSDDEASQPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGIQFKPMEPLQPIVPPAPLPMLPLSPQAGDSESLESQL
AQSRKQVAKKSTSFRPGSVSSGHSSPTSPTLSENVPPGKIGMNQTYRSPSASVTSTPAPA
APSGPPAPPGPLAPPGPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRP
MRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFET
GCDFLYLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYS
KERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTVQATACTPGGQINPSSGYQHK
RLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF
VCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPSSSDSSGVDMKDQ
EDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKESELSEVTSKDSR
APDRGPPHVPITPSGSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSE
GGDGRAGGGRGEAERASTSGLSFKDEGDSKQSKKEDPEDRNKMSVVTEGSQNHGHNPPMK
SEGLRRPASKISMLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTTGQTSATAVD
SDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGE
SAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAF
FASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcatgagtttggctgcagcgccagctgcggcggactctgca
gagattgctgagctgcagcaggcagtggttgaagagctgggtatctctatggaggaactt
cgtcagttcatcgatgaagaactggaaaagatggactgtatacagcagcgcaagaagcag
ctggcagagctggagacgtgggtgctgcagaaggagtctgaggtggcttatgttgatcgg
ctgtttgatgatgcatctagggaagtgactaattgtgagtctttggtgaaggatttctac
tctaagctgggattacagtatcatgacagtagctctgacgatgaagcttcccagcctaca
gagataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacgccaaaagatcagaagcttcgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtgaataagaaaagcagttctcaagatcta
cataaaggaaccttgggtcaggtgtctggagaactgagcaaagatggggacctgatagtc
agcatgcggattctgggcaagaagaggactaagacgtggcacaaaggcaccctcattgcc
atccagactgtcgggctaggaaagaaatacaaagtgaaatttgacaacaaaggaaagagt
ctgctgtctgggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaaatacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagacccctaacgtcaagaacaagctcagatttttaattttttttgatgatggc
tatgcttcctatgtcactcagtccgagctgtatcccatttgccgaccattgaaaaagact
tgggaggacatagaagacagctcctgccgagacttcatagaagaatatatcactgcctat
ccaaaccgcccaatggtacttctcaagagtggccagcttattaagactgagtgggaaggc
acatggtggaagtctcgagttgaagaggttgatggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgagtggatctatcgaggctctacacgcctggaacctatgttcagt
atgaagacatcctcagcctctgcaatggagaagaagcaaggggggcaactcagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtacactcaggatctaacg
agtactggaatccagtttaagcccatggagcccctgcagcctatagtcccacctgccccg
cttcccatgcttcctctttccccccaggcaggcgacagtgaaagcttagaaagccagctt
gctcaatcacggaagcaagtagccaaaaagagcacatcattccgaccaggatctgtgagt
tctggccattcctcccctacttcgcccacactcagtgaaaatgtaccccctgggaaaatt
ggaatgaaccagacatacagatcaccttcagcctctgtaacatctaccccagcacctgca
gccccttctgggcctccagcccctccagggcctcttgctcctcctggaccaccggcccct
ccagctttccacggcatgttagagcgggcaccagctgagccctcctatcgtgcccctatg
gagaagcttttctatttacctcatgtctgcagttacacttgtttgtcccggattagaccc
atgaggaatgaacaatatcggggcaaaaaccctctactggtcccactattgtatgacttc
cggaggatgacagcacgtcgcagagttaaccgcaagatgggcttccatgtaatctataag
acaccctgtggtctctgccttcggacgatgcaggaaatagagcgctacctttttgagact
ggctgtgacttcctgtacctggagatgttctgtttggatccatatgtccttgttgacaga
aagttccagccctttaaacctttttactatattttggacatcacctatggcaaagaagat
gttcccctgtcctgtgttaatgagattgacacaactcccccaccccaggtggcctacagc
aaggaacgcattcctggcaagggtgttttcattaacacaggccctgaatttctggttggc
tgtgactgcaaggatgggtgtcgggataaatccaagtgtgcctgccatcagctcactgtc
caggccacagcctgtaccccagggggtcagatcaaccctagctccggctaccagcacaaa
agactagaagagtgtctgcccacaggggtttatgagtgtaacaagcgctgcaaatgtgac
ccaaacatgtgcacaaatcggttggtgcagcatggactgcaggttcgactacagctgttt
aagacacagaacaagggctggggcatccgctgcttggatgacattgctaaaggctctttt
gtctgcatttatgcaggcaaaatcctgacagatgactttgcagacaaagaaggcctcgag
atgggtgatgagtactttgcaaatctggaccacattgaaagtgtggagaacttcaaggaa
ggatatgagagtgacgtccccagctcctctgacagcagtggggtggatatgaaggaccag
gaggatggcaacagtggctcagaggaccctgaggagtccaacgacgacagctccgatgac
aacttctgtaaggacgaggacttcagcaccagttcagtgtggcgtagctatgcaacccgg
aggcagactcggggtcagaaggagagtgaactgtctgaggtgacttcaaaggactcccgc
gccccagaccgtgggcctccccacgtccctatcactccctcaggatctgtagggggttgc
aatccaccttcctccgaagagacacccaagaacaaggtggcctcatggttgagctgcaat
agtgtcagtgaaggtggatttgctgactctgacagccgttcctcctttaagactagtgaa
ggtggagatggccgtgctgggggaggccggggagaggctgaaagagcctctacctcagga
ttgagcttcaaggatgaaggagacagtaagcaatctaaaaaagaggaccctgaggaccga
aacaagatgtcagtagttactgaaggctctcagaatcatggacacaatcctcccatgaag
tctgaagggcttcgccgaccagctagtaaaatttctatgctccagagccagcgagttgtg
acttctactcagtcaaaccctgatgatatcctaacactgtccagcagcacagaaagtgag
ggggaaagtggaaccagccgaaagcccactactggtcagacttcagccacagcagttgac
agtgatgacatccagaccatctcttctggctctgatggcgatgactttgaggacaagaag
aacttgtcgggaccaacaaagcgtcaggtggcagtaaaatcaacccgaggctttgctctt
aaatcaacccatggtattgccattaaatcaaccaacatggcttccgtggacaagggggag
agtgcaccagttcgtaagaacacacgccagttctatgatggtgaagagtcttgctacatc
attgatgccaaacttgaaggcaacctaggccgctacctcaatcacagttgcagccccaac
ctgtttgtccagaacgtttttgtggatacccatgatcttcgcttcccttgggtggccttt
tttgccagcaagagaatccgggctggaacagaactcacttgggattacaactatgaagtg
ggcagtgtggaaggcaaggaactgctgtgctgctgtggagccattgaatgcagagggcgg
cttctctag

DBGET integrated database retrieval system