KEGG   Rattus norvegicus (rat): 689883Help
Entry
689883            CDS       T01003                                 

Gene name
Setdb1
Definition
SET domain, bifurcated 1 (EC:2.1.1.43)
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    689883 (Setdb1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     689883 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 1302 aa AA seqDB search
MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQFIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSDDEASQPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGIQFKPMEPLQPIVPPAPLPMLPLSPQAGDSESLESQL
AQSRKQVAKKSTSFRPGSVSSGHSSPTSPTLSENVPPGKIGMNQTYRSPSASVTSTPAPA
APSGPPAPPGPLAPPGPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRP
MRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFET
GCDFLYLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYS
KERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTVQATACTPGGQINPSSGYQHK
RLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF
VCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPSSSDSSGVDMKDQ
EDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKESELSEVTSKDSR
APDRGPPHVPITPSGSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSE
GGDGRAGGGRGEAERASTSGLSFKDEGDSKQSKKEDPEDRNKMSVVTEGSQNHGHNPPMK
SEGLRRPASKISMLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTTGQTSATAVD
SDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGE
SAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAF
FASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcatgagtttggctgcagcgccagctgcggcggactctgca
gagattgctgagctgcagcaggcagtggttgaagagctgggtatctctatggaggaactt
cgtcagttcatcgatgaagaactggaaaagatggactgtatacagcagcgcaagaagcag
ctggcagagctggagacgtgggtgctgcagaaggagtctgaggtggcttatgttgatcgg
ctgtttgatgatgcatctagggaagtgactaattgtgagtctttggtgaaggatttctac
tctaagctgggattacagtatcatgacagtagctctgacgatgaagcttcccagcctaca
gagataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacgccaaaagatcagaagcttcgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtgaataagaaaagcagttctcaagatcta
cataaaggaaccttgggtcaggtgtctggagaactgagcaaagatggggacctgatagtc
agcatgcggattctgggcaagaagaggactaagacgtggcacaaaggcaccctcattgcc
atccagactgtcgggctaggaaagaaatacaaagtgaaatttgacaacaaaggaaagagt
ctgctgtctgggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaaatacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagacccctaacgtcaagaacaagctcagatttttaattttttttgatgatggc
tatgcttcctatgtcactcagtccgagctgtatcccatttgccgaccattgaaaaagact
tgggaggacatagaagacagctcctgccgagacttcatagaagaatatatcactgcctat
ccaaaccgcccaatggtacttctcaagagtggccagcttattaagactgagtgggaaggc
acatggtggaagtctcgagttgaagaggttgatggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgagtggatctatcgaggctctacacgcctggaacctatgttcagt
atgaagacatcctcagcctctgcaatggagaagaagcaaggggggcaactcagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtacactcaggatctaacg
agtactggaatccagtttaagcccatggagcccctgcagcctatagtcccacctgccccg
cttcccatgcttcctctttccccccaggcaggcgacagtgaaagcttagaaagccagctt
gctcaatcacggaagcaagtagccaaaaagagcacatcattccgaccaggatctgtgagt
tctggccattcctcccctacttcgcccacactcagtgaaaatgtaccccctgggaaaatt
ggaatgaaccagacatacagatcaccttcagcctctgtaacatctaccccagcacctgca
gccccttctgggcctccagcccctccagggcctcttgctcctcctggaccaccggcccct
ccagctttccacggcatgttagagcgggcaccagctgagccctcctatcgtgcccctatg
gagaagcttttctatttacctcatgtctgcagttacacttgtttgtcccggattagaccc
atgaggaatgaacaatatcggggcaaaaaccctctactggtcccactattgtatgacttc
cggaggatgacagcacgtcgcagagttaaccgcaagatgggcttccatgtaatctataag
acaccctgtggtctctgccttcggacgatgcaggaaatagagcgctacctttttgagact
ggctgtgacttcctgtacctggagatgttctgtttggatccatatgtccttgttgacaga
aagttccagccctttaaacctttttactatattttggacatcacctatggcaaagaagat
gttcccctgtcctgtgttaatgagattgacacaactcccccaccccaggtggcctacagc
aaggaacgcattcctggcaagggtgttttcattaacacaggccctgaatttctggttggc
tgtgactgcaaggatgggtgtcgggataaatccaagtgtgcctgccatcagctcactgtc
caggccacagcctgtaccccagggggtcagatcaaccctagctccggctaccagcacaaa
agactagaagagtgtctgcccacaggggtttatgagtgtaacaagcgctgcaaatgtgac
ccaaacatgtgcacaaatcggttggtgcagcatggactgcaggttcgactacagctgttt
aagacacagaacaagggctggggcatccgctgcttggatgacattgctaaaggctctttt
gtctgcatttatgcaggcaaaatcctgacagatgactttgcagacaaagaaggcctcgag
atgggtgatgagtactttgcaaatctggaccacattgaaagtgtggagaacttcaaggaa
ggatatgagagtgacgtccccagctcctctgacagcagtggggtggatatgaaggaccag
gaggatggcaacagtggctcagaggaccctgaggagtccaacgacgacagctccgatgac
aacttctgtaaggacgaggacttcagcaccagttcagtgtggcgtagctatgcaacccgg
aggcagactcggggtcagaaggagagtgaactgtctgaggtgacttcaaaggactcccgc
gccccagaccgtgggcctccccacgtccctatcactccctcaggatctgtagggggttgc
aatccaccttcctccgaagagacacccaagaacaaggtggcctcatggttgagctgcaat
agtgtcagtgaaggtggatttgctgactctgacagccgttcctcctttaagactagtgaa
ggtggagatggccgtgctgggggaggccggggagaggctgaaagagcctctacctcagga
ttgagcttcaaggatgaaggagacagtaagcaatctaaaaaagaggaccctgaggaccga
aacaagatgtcagtagttactgaaggctctcagaatcatggacacaatcctcccatgaag
tctgaagggcttcgccgaccagctagtaaaatttctatgctccagagccagcgagttgtg
acttctactcagtcaaaccctgatgatatcctaacactgtccagcagcacagaaagtgag
ggggaaagtggaaccagccgaaagcccactactggtcagacttcagccacagcagttgac
agtgatgacatccagaccatctcttctggctctgatggcgatgactttgaggacaagaag
aacttgtcgggaccaacaaagcgtcaggtggcagtaaaatcaacccgaggctttgctctt
aaatcaacccatggtattgccattaaatcaaccaacatggcttccgtggacaagggggag
agtgcaccagttcgtaagaacacacgccagttctatgatggtgaagagtcttgctacatc
attgatgccaaacttgaaggcaacctaggccgctacctcaatcacagttgcagccccaac
ctgtttgtccagaacgtttttgtggatacccatgatcttcgcttcccttgggtggccttt
tttgccagcaagagaatccgggctggaacagaactcacttgggattacaactatgaagtg
ggcagtgtggaaggcaaggaactgctgtgctgctgtggagccattgaatgcagagggcgg
cttctctag

DBGET integrated database retrieval system