KEGG   Rattus norvegicus (rat): 690675Help
Entry
690675            CDS       T01003                                 

Definition
similar to Cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
rno  Rattus norvegicus (rat)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    690675
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    690675
   04115 p53 signaling pathway
    690675
 Human Diseases
  Cancers
   05200 Pathways in cancer
    690675
   05210 Colorectal cancer
    690675
   05222 Small cell lung cancer
    690675
  Neurodegenerative diseases
   05010 Alzheimer's disease
    690675
   05012 Parkinson's disease
    690675
   05014 Amyotrophic lateral sclerosis (ALS)
    690675
   05016 Huntington's disease
    690675
  Cardiovascular diseases
   05416 Viral myocarditis
    690675
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    690675
  Infectious diseases
   05134 Legionellosis
    690675
   05152 Tuberculosis
    690675
   05164 Influenza A
    690675
   05161 Hepatitis B
    690675
   05168 Herpes simplex infection
    690675
   05145 Toxoplasmosis
    690675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAAGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKGERADLIAYLKKTTNE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcagaagtgtgcccagtgccacact
gtggaaaaaggaggcaagcataagactggaccaaacctccatggtctgtttgggcggaag
acaggccaggctgctggattctcttacacagatgccaacaagaacaaaggcatcacctgg
ggagaggataccctgatggagtatttggaaaatcccaaaaagtacatccctggaacaaaa
atgatctttgctggaattaagaagaagggagaaagggcagacctaatagcttatcttaaa
aagactactaatgagtaa

DBGET integrated database retrieval system