KEGG   Rattus norvegicus (rat): 690987Help
Entry
690987            CDS       T01003                                 

Gene name
Gys1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    690987 (Gys1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    690987 (Gys1)
   04152 AMPK signaling pathway
    690987 (Gys1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    690987 (Gys1)
   04922 Glucagon signaling pathway
    690987 (Gys1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    690987 (Gys1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     690987 (Gys1)
Glycosyltransferases [BR:rno01003]
 Polysaccharide
  Storage polysaccharide
   690987 (Gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 690987
NCBI-ProteinID: NP_001103085
RGD: 1589798
Ensembl: ENSRNOG00000020812
UniProt: A2RRU1
Position
1q22
AA seq 738 aa AA seqDB search
MPLSRSLSMSSLPGLEDWEDEFDPENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPYVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPDHFTYEPHEVDATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPLREDSERYDEEEEAAKDRRNIRAPEWPRRASCSSSTGGSKRSNSVDTGPSSSL
STPTEPLSPTSSLGEERN
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcagccgcagtctctctatgtcctcgcttccaggattggaagactgggaggat
gaattcgacccggagaacgcagtgcttttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacactgtgctgcagacgaaggcgaaggtgaccggggatgaatggggtgac
aactactatctggtgggaccatacacggagcagggtgtgaggacgcaggtggagctcctg
gagcccccaactcctgaactgaagaggactctggattccatgaacagcaagggctgtaag
gtgtattttgggcgttggctgatcgaggggggacccctagtggtgctcctggatgtaggg
gcctcagcctgggccctggagcgctggaagggtgaactttgggacacctgcaacatcggg
gtaccctggtacgaccgtgaggccaatgatgccgtcctgtttggtttcctcaccacctgg
ttcctgggtgagttcctggcccagaatgaagagaagccatatgtggtcgcccacttccat
gaatggttggcaggcgttggtctgtgtctgtgccgagcccggcgtttgccggtggcaacc
atcttcaccactcacgccacgctgctgggtcgctacctatgtgctggtgccgtggacttc
tacaacaacctggagaatttcaatgtagacaaggaagcaggcgagaggcagatctatcac
cggtactgcatggagcgggcagcagcccactgtgcccatgtcttcactacagtgtcccag
atcaccgcgattgaggctcaacacctcctcaagaggaaaccagatattgtgacccccaat
ggactaaatgtgaagaagttctctgctatgcacgaattccagaaccttcacgctcagagc
aaagcacgaatccaggagtttgtgcgtggccatttttatgggcacctggacttcaaccta
gacaagactttgtatttctttatcgctggacgctatgagttttccaacaagggagctgat
atattcctggaggcattggcccggctcaactacctgctcagagtgaatggcagcgagcaa
actgttgtggcattcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctg
aagggccaagccgtgcgcaaacagctatgggacacagccaatacagtcaaggagaaattt
gggaggaagctctacgaatccctattagtgggtagcctccccgacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgcgactcagcggcagtctttc
ccaccggtgtgtacccacaacatgctggatgactcttcagaccccatcttgaccaccatc
cgacgaatcggccttttcaacagtagtgcggaccgtgtgaaggtgatttttcacccagaa
ttcctttcttccacaagccctctgctccccgtggactatgaagagttcgtccgtggctgt
caccttggagtcttcccctcctactatgagccctggggctacacaccagcggagtgcact
gtcatgggcatcccgagcatctccacgaacctctccggctttggctgctttatggaggag
cacattgcagatccctcggcttacggcatttacattctggatcggaggttccgaagcctg
gatgattcatgctcccaactcacctccttcctgtacagcttctgtcagcagagccggcga
cagcgcatcattcagcggaatcgcacagagcgattgtcagacctgctggattggaagtac
ctaggccggtactacatgtctgcgcgccacatggctctggccaaggcctttccagaccac
ttcacctatgagccccatgaggtagatgcgacccaggggtaccgttacccacggccggcc
tccgtgccaccgtcaccctcactgtctcgacactccagcccacaccagagtgaggatgaa
gaagagccacgggatggacccctgagggaagacagtgagcgttatgatgaggaagaagag
gctgccaaggaccgccgcaacatccgggcacccgagtggccacgccgggcctcctgctcc
tcctccacaggcggcagcaagagaagcaactcagtggacactgggccctccagctcactc
agtacacccactgagcccctgagtcctaccagttccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system